DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy4

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001348533.1 Gene:Adcy4 / 104110 MGIID:99674 Length:1077 Species:Mus musculus


Alignment Length:263 Identity:83/263 - (31%)
Similarity:142/263 - (53%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 QHCSKLEIMFEK----EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERM----RKSEEHV 486
            ::..:|:.:::|    |.:.::.:|....|          ||.:::|..:|.:.    |::|:..
Mouse   813 EYYCRLDFLWKKKLRQEREETETMENLTRL----------LLENVLPAHVAPQFIGQNRRNEDLY 867

  Fly   487 CQSFEEVSVIFIEVMNI--YDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVETVGMV 546
            .||:|.|.|:|..|.:.  :.|.||...:.::.:..||::.:..||.:..|   .|.|::|:|..
Mouse   868 HQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGST 932

  Fly   547 YMAVSG-----APDVNPLHAEHAC-------DLALRVMKK---VKAHALPGVAIRVGINSGPVVA 596
            |||.:|     ..|... .:|.:|       :.|:.:..|   :..|:.....:|||:|.|||||
Mouse   933 YMAATGLNATSGQDTQQ-DSERSCSHLGTMVEFAVALGSKLGVINKHSFNNFRLRVGLNHGPVVA 996

  Fly   597 GVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMET 661
            ||:|.:.|:|.::|:|||.||||||:.....||::..||..:|.:||...:||.:|||||||:.|
Mouse   997 GVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYSRGSIKVKGKGELCT 1061

  Fly   662 YWL 664
            |:|
Mouse  1062 YFL 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 9/52 (17%)
Nucleotidyl_cyc_III 488..665 CDD:416391 72/197 (37%)
Adcy4NP_001348533.1 AC_N <115..246 CDD:318454
Guanylate_cyc 264..418 CDD:306677
DUF1053 479..580 CDD:368844
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..524
Guanylate_cyc 866..1065 CDD:306677 72/200 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.