DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gucy2d

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_002942678.2 Gene:gucy2d / 100496590 XenbaseID:XB-GENE-1014102 Length:1081 Species:Xenopus tropicalis


Alignment Length:248 Identity:98/248 - (39%)
Similarity:146/248 - (58%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 QHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVS 494
            |:.|.||.:.   .:|::|||..       |::.|:||..|:|..:||.::.......:.|:||:
 Frog   801 QYSSNLEDLI---RERTEELEVE-------KQKTDKLLTQMLPPSVAEALKTGTPVEPEYFDEVT 855

  Fly   495 VIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN-P 558
            :.|.:::..  :..:::.|.::.|..||.:::..|..|.|..||||||:|..||..||.|..| .
 Frog   856 IYFSDIVGF--TTISSLSDPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKTNGN 918

  Fly   559 LHAEHACDLALRVMKKV---KAHALPG--VAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASR 618
            .||....:::|.::..|   |...:|.  |.||:|::|||.||||||:.:|||||||||||||||
 Frog   919 RHAAEIANMSLDILSSVGSFKMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASR 983

  Fly   619 MESSSDPWM--IQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWLL--EG 667
            |||:..|:.  :.||..|.|...|.||:.|.||..::||||..:||||:  ||
 Frog   984 MESTGLPYRVHVNLSTVTILHSLKEGYRFEVRGKTELKGKGVEDTYWLVGKEG 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 16/48 (33%)
Nucleotidyl_cyc_III 488..665 CDD:416391 79/184 (43%)
gucy2dXP_002942678.2 PBP1_sensory_GC_DEF-like 43..411 CDD:380594
PK_GC-2D 519..786 CDD:270945
HNOBA <795..840 CDD:400168 16/48 (33%)
CYCc 820..1012 CDD:214485 77/200 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.