DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gucy1b1

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:691 Identity:193/691 - (27%)
Similarity:321/691 - (46%) Gaps:113/691 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYGMLYESVQHYIQQEYGMETW---RKVCQIVDCKHQSFKTHQIYPDKLMPDFAAA----LSAST 58
            |||.:..:::..:.:.||.|.|   :|..|:.:  ...|....||.|....|..:|    |:.:.
 Frog     1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDE--EGQFLVRIIYDDSKTYDLVSAATKVLNLNA 63

  Fly    59 GESFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQLTN 123
            |:    .:..||..|..|....|||.::|..|....:|||::|.:|..:...||.|::||.:.|:
 Frog    64 GD----ILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTD 124

  Fly   124 MD-DDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIKLTEGPLT 187
            .: ..|.::.|.|.|.|:...:||.:..||::.:|.::...|::.:|:.|..|...|:..:....
 Frog   125 AEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTREE 189

  Fly   188 VIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMKITLAGEKIVETW 252
            ...:.:..|:.......|::..              .|.:.|||.|:.|.|:.:|..|..|....
 Frog   190 DFYEDQDRFEENGTQESRISPY--------------TFCKAFPFHIMFDRDLFVTQCGNAIYRVL 240

  Fly   253 ILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFD 317
            ....||               .|                 .:|..|.|:|. |        ::..
 Frog   241 PQLQPG---------------NC-----------------NLLSVFSLVRP-H--------IDIS 264

  Fly   318 FENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEIDPATGQRRHSVGLRSILLKGQM 382
            |...     |:....:.:..:||...:..|.|      |:||:   ||..     :..:.|||||
 Frog   265 FHGI-----LSHINTVFVLRSKEGLLDVEKSE------SEDEL---TGTE-----ISCLRLKGQM 310

  Fly   383 FYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQH------CSKLEIMFEK 441
            .|:.:.|:::|||||.:.|||:|...||||:|:..|..:|:||:.|.|.      ..:|||:   
 Frog   311 IYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEIL--- 372

  Fly   442 EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVM--NIY 504
                :|.|:.:|...:..|::.|.||||::|..:|..:|.......:.::.|:::|..::  |.:
 Frog   373 ----TDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTF 433

  Fly   505 DSGSNNIQDAMQAVTTLNKVFSALD---EEIISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACD 566
            .|...:.:.||:.|..||.:::..|   :...:|:||||||||..||.|||.|:....||...|.
 Frog   434 CSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICH 498

  Fly   567 LALRVMKKVKAHALPG--VAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQ 629
            |||.:|:......:.|  |.|.:||::|.||.||:|.::|||||||:|||..||.|::.:...|.
 Frog   499 LALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKIN 563

  Fly   630 LSNYT-----ALKVQKVGYKVEARGFVKVKGKGEMETYWLL 665
            :|.||     :.:.....:.::.||.|.:|||.:....|.|
 Frog   564 VSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFL 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167 46/166 (28%)
HNOBA 218..479 CDD:400168 70/266 (26%)
Nucleotidyl_cyc_III 488..665 CDD:416391 67/188 (36%)
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902 46/169 (27%)
HNOBA 207..406 CDD:369471 71/279 (25%)
Guanylate_cyc 412..605 CDD:306677 68/193 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.