DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and Adcy2

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_112269.2 Gene:Adcy2 / 81636 RGDID:619965 Length:1095 Species:Rattus norvegicus


Alignment Length:462 Identity:114/462 - (24%)
Similarity:195/462 - (42%) Gaps:108/462 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 LFQCRRPKDTTIDWDTLIQMRAVLFEFELIRTGHNRAAYDAVLNMDFENYDEMDLNEAQTMALAK 336
            |.||.:...|::.|  |::...::......|..........:|.|...|...:..:|..|:..|.
  Rat   655 LLQCSKKASTSLMW--LLKSSGIIANRPWPRISLTIVTTAIILTMAVFNMFFLSNSEETTLPTAN 717

  Fly   337 AQEFSESHPVDDDESAREDEIDPATGERRSSQGLRSILLKGQMFYIK------------------ 383
            ....:.|.|   |..|                   |||....:|::.                  
  Rat   718 TSNANVSVP---DNQA-------------------SILHARNLFFLPYFIYSCILGLISCSVFLR 760

  Fly   384 ---DVDSLIFLCSPLIENLDELH-----------------GIGLYLNDLNPHGLS---RELVMAG 425
               ::..||.:.:.:..|...||                 ||...|..:....||   ..|::.|
  Rat   761 VNYELKMLIMMVALVGYNTILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLG 825

  Fly   426 WQ---HCSKLEIM----FEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE----RMRLS 479
            .|   :| :|:.:    |:||.:..:.:|....:          ||.:::|..:||    |...:
  Rat   826 RQSEYYC-RLDFLWKNKFKKEREEIETMENLNRV----------LLENVLPAHVAEHFLARSLKN 879

  Fly   480 EEQVCQSFEEVSVIFLEV---MNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISP---FVYKVE 538
            ||...||::.|.|:|..:   ...|.|...:.:| ::.:..||::.:..|:.:..|   .|.|::
  Rat   880 EELYHQSYDCVCVMFASIPDFKEFYTESDVNKEG-LECLRLLNEIIADFDDLLSKPKFSGVEKIK 943

  Fly   539 TVGMVYMAVSG-----------APDVNPLHAEHACDLALRVMKKFKA---HDMGDVAIRVGINSG 589
            |:|..|||.:|           .|:...:|.....:.|..::.|..|   |...|..:|||||.|
  Rat   944 TIGSTYMAATGLSAIPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHG 1008

  Fly   590 PVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKG 654
            ||:|||:|.:.|:|.::|:|||.||||:|:....|||:::.|...::.:||....||.:.|||||
  Rat  1009 PVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKG 1073

  Fly   655 DMETYWL 661
            |::||::
  Rat  1074 DLKTYFV 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 45/255 (18%)
CYCc 457..643 CDD:214485 64/209 (31%)
Guanylate_cyc 485..662 CDD:278633 66/197 (34%)
Adcy2NP_112269.2 AC_N <37..264 CDD:318454
Guanylate_cyc 285..469 CDD:306677
DUF1053 499..603 CDD:399378
Guanylate_cyc 882..1081 CDD:306677 66/200 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.