DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and si:dkey-37g12.1

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_021333677.1 Gene:si:dkey-37g12.1 / 796669 ZFINID:ZDB-GENE-090312-145 Length:882 Species:Danio rerio


Alignment Length:473 Identity:130/473 - (27%)
Similarity:213/473 - (45%) Gaps:117/473 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 VMDLFQCRRPKDTTIDWDTLIQMRAVLFEFELIRTGHNRAAYDAVLNMDFENYDEMD----LNEA 329
            :.|:.|....|   :||         .|:|.|:        .|.|..||:.::..:.    |:.:
Zfish   444 LQDILQNESIK---LDW---------TFKFSLM--------LDIVKGMDYLHHSPLQYHGHLSSS 488

  Fly   330 QTMA----LAKAQEF---------SESHPVDDDESA---REDEI----DPATGERRSSQG----- 369
            ..:.    :.|..:|         :|..|..|..:|   |..|:    .||.|.::....     
Zfish   489 SCVVDSRFVLKVTDFGLNSVRRLDTEQSPGSDPWTALLWRAPELLRQSIPANGTQKGDVYSFAII 553

  Fly   370 LRSILLKGQMFYI-------KDVDSLIFL--CSP---------LIENLDEL-------------- 402
            .:.::.:...|||       :::...:..  |||         .:|.|:.|              
Zfish   554 AQEVVYRRGPFYIPNSHFSPREIVERVRAGGCSPSRPYIDRAECVEELESLVVSCWRETPAERPD 618

  Fly   403 -HGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDEL-----EKSLELADSWKRQGD 461
             ..|...:...:|||:|..:          |:.:..:.||.:..|     |::.||.:. |::.:
Zfish   619 FSYIRTAIKKNSPHGVSENI----------LDDLLSRMEQYACNLEEIVSERTAELQEE-KKRAE 672

  Fly   462 ELLYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGA---MQTVNTLNKVFS 523
            .||..|:||.:|.::...:....::::.|::.|.::     ||..::..:   ||.||.||.:::
Zfish   673 GLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDI-----EGFTAMSASLTPMQVVNVLNDLYT 732

  Fly   524 ALDEEIISPFVYKVETVGMVYMAVSGAPDVN-PLHAEHACDLALRVMKKFKAHDMGDV-----AI 582
            ..|..|....||||||:|..||.|||.|..| ..||:....::|.:::..::.....|     .:
Zfish   733 YFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSPHVPEQQLRV 797

  Fly   583 RVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTG---DKVRQVGYKVES 644
            |:|::|||.||||||.|:||||||||||||||||||...|.||.:|..|.   |..|  .::.|.
Zfish   798 RIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFR--NFRCEL 860

  Fly   645 RGTVQVKGKGDMETYWLL 662
            ||.:.:||||.:.|:|||
Zfish   861 RGDIHIKGKGWVRTFWLL 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 52/273 (19%)
CYCc 457..643 CDD:214485 74/197 (38%)
Guanylate_cyc 485..662 CDD:278633 76/188 (40%)
si:dkey-37g12.1XP_021333677.1 Periplasmic_Binding_Protein_Type_1 <59..258 CDD:324556
PKc_like 355..628 CDD:328722 34/203 (17%)
HNOBA <641..687 CDD:311573 13/46 (28%)
CYCc 666..850 CDD:214485 72/189 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.