DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and Gucy2g

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001074545.1 Gene:Gucy2g / 73707 MGIID:106025 Length:1100 Species:Mus musculus


Alignment Length:538 Identity:152/538 - (28%)
Similarity:233/538 - (43%) Gaps:136/538 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LKMPTVKLDVFL-------DLFPFTFVLNHDMKITHAGEKIVETWIMHNPGANPKSFIGTHVMDL 272
            :|.|||:.:|.|       ::.||..|......|.     ||..:....              .|
Mouse   595 VKKPTVRREVCLMCELKHENIVPFFGVCTEPPNIC-----IVTQYCKKG--------------SL 640

  Fly   273 FQCRRPKDTTIDW-----------------------------------DTLIQMRAVLFEFELIR 302
            ....|..|..|||                                   |:.:|::...|.....:
Mouse   641 QDVMRNSDHEIDWIFKLSFAYDIVNGLLFLHGSPLRSHGNLKPSNCLVDSHMQLKLSGFGLWEFK 705

  Fly   303 TGHNRAAYDAVLNMDFENYDE--------MDLNEAQTMALAKAQEFS-----------ESH-PVD 347
            .|....:|    |.:..::.|        :.|.|:......:...:|           ::| |.:
Mouse   706 HGSTWRSY----NQEATDHSELYWTAPELLRLRESPCSGTPQGDVYSFAILLRDLIHQQAHGPFE 766

  Fly   348 DDESAREDEI----DPATGERRSSQGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELH----G 404
            |.|:|.|:.|    ||     |:...||..||:.     |....::.|.....:...||.    .
Mouse   767 DLEAAPEEIISRIKDP-----RAPVPLRPSLLED-----KGDGRIVALVRECWDESPELRPIFPS 821

  Fly   405 IGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLE------LADSWKRQGDEL 463
            |...|.:.:|.|           |.|.|:.|..|.|..::.||:.:|      :|:  ||:.::|
Mouse   822 IKKTLREASPRG-----------HVSILDSMMGKLETYANHLEEVVEERTRELVAE--KRKVEKL 873

  Fly   464 LYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEE 528
            |.:|:|..:.|::...:....:.||.|::.|.:::..  ..|.|:...:|.|..||.::|..|..
Mouse   874 LSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGF--TKLCSLSSPLQVVKLLNDLYSLFDHT 936

  Fly   529 IISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACDLA------LRVMKKFKAHDMGD--VAIRVG 585
            |.|..||||||:|..||..||.|..|  .|:||.::|      |.|...|:...|.:  :.:|:|
Mouse   937 IQSHDVYKVETIGDAYMVASGLPIRN--GAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIG 999

  Fly   586 INSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYT-GDKVRQVGYKVESRGTVQ 649
            :::|||||||||..:|||||||||||.||||||||.|.:|.:|:.| |..:...||.::.|||:.
Mouse  1000 LHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTIS 1064

  Fly   650 VKGKGDMETYWLLEGPEG 667
            |||||:..|:| |:|.:|
Mouse  1065 VKGKGEQTTFW-LKGKDG 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 66/333 (20%)
CYCc 457..643 CDD:214485 79/194 (41%)
Guanylate_cyc 485..662 CDD:278633 82/185 (44%)
Gucy2gNP_001074545.1 PBP1_GC_G-like 47..436 CDD:380595
PK_GC 555..829 CDD:270894 48/266 (18%)
CYCc 865..1055 CDD:214485 78/195 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.