DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and adcy1b

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001161822.1 Gene:adcy1b / 569499 ZFINID:ZDB-GENE-100805-1 Length:1114 Species:Danio rerio


Alignment Length:306 Identity:94/306 - (30%)
Similarity:140/306 - (45%) Gaps:59/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 LYLNDLNPHGLSRELVMAGWQHCS--------KLEIMFEKEEQRSDELEKSLELADSWKRQGDE- 462
            ||:..|...|..|   .:||...|        .|.:........|.:|:..|.|...|..|.:| 
Zfish   741 LYITILELSGFRR---ASGWALLSVRGLEPLLSLLLFSTAVALHSRQLDLKLRLDFLWATQAEEE 802

  Fly   463 -------------LLYSMIPRPIAERMRLSE----EQVCQSFEEVSVIFLEVMNVYD-----EGL 505
                         :|::::|..:|:...||.    :...||:.:|.|:|..:.|..|     :|.
Zfish   803 RDGMEKVKLDNKRILFNLLPVHVAQHFLLSNPRNMDLYYQSYAQVGVLFASIPNFNDFYIELDGN 867

  Fly   506 NSIQGAMQTVNTLNKVFSALDEEIISPFVY----KVETVGMVYMAVSG--------APDVNPLHA 558
            |.   .::.:..||::.:..| |::....|    |::|:|..||:..|        |......|.
Zfish   868 NM---GVECLRLLNEIIADFD-ELMDKECYKDIEKIKTIGSTYMSAVGLVPTIGTKAKKSTATHL 928

  Fly   559 EHACDLALR---VMKKFKAHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSS 620
            ....|.|:.   |:.:.......|..:|||||.|||||||:|.:.|:|.::|:|||.||||:|:.
Zfish   929 STIADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTG 993

  Fly   621 DPWKIQLSKYTGDKVR--QVGYKVESRGTVQVKGKGDMETYWLLEG 664
            .|.|||:   |.|..|  |..|.:..||.|.|||||.|.||: |||
Zfish   994 VPGKIQV---TEDVYRLLQNNYDLMCRGNVSVKGKGQMLTYF-LEG 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 19/90 (21%)
CYCc 457..643 CDD:214485 66/225 (29%)
Guanylate_cyc 485..662 CDD:278633 70/198 (35%)
adcy1bNP_001161822.1 AC_N <128..270 CDD:292831
CYCc 236..431 CDD:214485
Guanylate_cyc 272..454 CDD:278633
DUF1053 498..585 CDD:283888
CYCc 806..1012 CDD:214485 63/212 (30%)
Guanylate_cyc 839..1035 CDD:278633 71/203 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.