DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and npr3

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:292 Identity:64/292 - (21%)
Similarity:101/292 - (34%) Gaps:87/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 KDVDSLIFLCSPLIENLDELHGIGLYLNDLN-------PHGL------SRELVMAGWQHCSKLEI 434
            ||..:..|....:...|.|.| |......||       |.|:      |..::|     |||.:|
Zfish   175 KDERNCYFTMEGVFTVLSEYH-ISTDFAVLNSNEERVDPDGIITSVYGSEVVIM-----CSKADI 233

  Fly   435 MFE------KEEQRSD-------ELEKSLELAD-SWKRQ---GDE------------LLYSMIP- 469
            :.:      :.:..||       ||..|....| ||:|:   .||            ||.|..| 
Zfish   234 VRDLMLAAHRRKLTSDSHIFFNIELFNSSSYGDGSWRRRDKYDDEARAAYSFLNTVTLLRSTKPE 298

  Fly   470 -RPIAERMRLSEEQ----VCQSFEEVSVIFLE------------VMNVYDEGLNSIQGAMQTVNT 517
             ...:..|:.|.:|    :|:....|: :|:|            :..|..:||....|...|.:.
Zfish   299 FEDFSIEMKKSLQQSNIPICEDCSAVN-MFMEGFHDALLLYAIALREVKSKGLTKKNGLEITHSM 362

  Fly   518 LNKVFSALDEEI-----------------ISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACDLA 565
            .|:.|..:..::                 ..|...|.||| |.|...:|:..:.|......  .:
Zfish   363 WNRTFEGIAGQVSLDANGDRNGDFSVVRMTDPESGKHETV-MNYFGTNGSFQILPGFKREW--FS 424

  Fly   566 LRVMKKFKAHDMGDVAIRVGINSGPVVAGVVG 597
            ||.:...|..|.....:.|...:|.:|.|::|
Zfish   425 LRTIPPPKPLDPSSGGLGVSAVTGIIVGGILG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 32/136 (24%)
CYCc 457..643 CDD:214485 39/191 (20%)
Guanylate_cyc 485..662 CDD:278633 28/142 (20%)
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 54/248 (22%)
ANF_receptor 46..389 CDD:279440 46/220 (21%)
TM_EphA1 436..468 CDD:214014 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.