DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and adcy7

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_021333246.1 Gene:adcy7 / 568726 ZFINID:ZDB-GENE-040713-1 Length:1119 Species:Danio rerio


Alignment Length:331 Identity:90/331 - (27%)
Similarity:154/331 - (46%) Gaps:77/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 ENLDELHGIGLYLNDLNPHGLSRELVM--AGWQHCSKL------------EIMFEKEEQ---RSD 444
            |||...:...||.|    |.....|::  ||.....|:            .::..::.:   |.|
Zfish   787 ENLFSNYNCLLYTN----HSCGDSLMVCKAGLMKHPKIMSCIYITLFLFTMLLISRQNEYCCRQD 847

  Fly   445 ELEKSLELADSWKRQGDE-----LLYSMIPRPIAERM-------------------RLSEEQVCQ 485
            .|.|:..|||..:.:..|     ||.:::|..:|...                   |..::...:
Zfish   848 FLLKNKNLADKEEVELCENLNRLLLENVLPAHVAALFVGENKKNEVGLLSAISLLNRKYKDLYYK 912

  Fly   486 SFEEVSVIFLEV---------MNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISP---FVYKVE 538
            |::.|.|:|..|         .::..|||       :.:..||::.:..||.:..|   .|.|::
Zfish   913 SYDCVCVMFASVPDFKEFYTECDINKEGL-------ECLRLLNEIIADFDELLSKPKFSGVEKIK 970

  Fly   539 TVGMVYMA---VSGAPDVNPLHAE-------HACDLALRVMKK---FKAHDMGDVAIRVGINSGP 590
            |:|..|||   :||.|:.:....|       :..:.|:.::.|   ...|......:|||||.||
Zfish   971 TIGSTYMAAAGLSGPPEQSNQDRERQNAQIGNMVEFAIALIGKLDGINRHSFNTFRLRVGINHGP 1035

  Fly   591 VVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGD 655
            |:|||:|.:.|:|.::|:|||.||||||:.:..|||:::.|...::.:||..|.||.:.|||||:
Zfish  1036 VIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETSIVLQNLGYSCECRGLINVKGKGE 1100

  Fly   656 METYWL 661
            ::|:::
Zfish  1101 LKTFFV 1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 23/100 (23%)
CYCc 457..643 CDD:214485 63/234 (27%)
Guanylate_cyc 485..662 CDD:278633 66/202 (33%)
adcy7XP_021333246.1 AC_N <129..248 CDD:318454
Guanylate_cyc 272..455 CDD:306677
DUF1053 487..613 CDD:310728
Guanylate_cyc 909..1106 CDD:306677 66/203 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.