DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and adcy5

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001165056.1 Gene:adcy5 / 562619 ZFINID:ZDB-GENE-081104-470 Length:1186 Species:Danio rerio


Alignment Length:343 Identity:104/343 - (30%)
Similarity:174/343 - (50%) Gaps:59/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 SILLK----GQMFYIKDVDSLIFLCS-----PLIENLDELHGIGLYLNDLNPHG----------- 416
            |:.|:    |::|.:..::.|..|..     .|.:|:|.|    :..|.|.|:.           
Zfish   851 SVFLQVSSIGKLFLMLFIEILYVLIMEVPEVSLFDNVDLL----VMANALAPNNGTCIVDTRVPL 911

  Fly   417 ------LSRELVMAGWQHCSKLE----IMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRP 471
                  :....|:|.:.|..::|    :.|..:.|.::|.|:..|| .::.|:   ||::::|:.
Zfish   912 KIVTPVVITVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEEL-QAYNRR---LLHNILPKD 972

  Fly   472 IA----ERMRLSEEQVCQSFEEVSVIFLEVMN---VYDEGLNSIQGAMQTVNTLNKVFSALDEEI 529
            :|    .|.|.::|...||.|.|:|:|..:.|   .|.| |.:....::.:..||::.:..| ||
Zfish   973 VAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVE-LEANNEGVECLRLLNEIIADFD-EI 1035

  Fly   530 ISPFVY----KVETVGMVYMAVSGAPD-----VNPLHAEHACDLALRVMKKFK---AHDMGDVAI 582
            ||...:    |::|:|..|||.||..|     ....|.....|.|:|:|.:.|   .|...:..:
Zfish  1036 ISEDQFRQLEKIKTIGSTYMAASGLNDSTYDKAGRSHIRALADYAMRLMDQMKYINEHSFNNFKM 1100

  Fly   583 RVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGT 647
            ::|:|.|||||||:|.:.|:|.::|:|||.||||:|:..|.:||::......:....|.:|.||.
Zfish  1101 KIGLNMGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPERIQVTTDLYQVLSSYNYTLEYRGV 1165

  Fly   648 VQVKGKGDMETYWLLEGP 665
            |:|||||:|.||:|..||
Zfish  1166 VKVKGKGEMMTYFLNGGP 1183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 28/137 (20%)
CYCc 457..643 CDD:214485 66/204 (32%)
Guanylate_cyc 485..662 CDD:278633 70/191 (37%)
adcy5NP_001165056.1 AC_N 1..388 CDD:292831
CYCc 354..548 CDD:214485
Guanylate_cyc 390..574 CDD:278633
DUF1053 598..687 CDD:283888
CYCc 961..1155 CDD:214485 65/198 (33%)
Guanylate_cyc 987..1181 CDD:278633 71/195 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.