DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and si:ch211-132f19.7

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_688903.4 Gene:si:ch211-132f19.7 / 560410 ZFINID:ZDB-GENE-130530-619 Length:1183 Species:Danio rerio


Alignment Length:267 Identity:84/267 - (31%)
Similarity:141/267 - (52%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE-LLYSMIPRPIA----ERMR 477
            ||:|     :..|:|:.::..  |...|:|...||     |:.:| |||:::|..:|    ||.|
Zfish   875 SRQL-----ETTSRLDFLWRL--QARQEVEDMKEL-----REHNECLLYNILPAHVARHFLERDR 927

  Fly   478 LSEEQVCQSFEEVSVIFLEV--MNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPF---VYKV 537
            .:|:...:|:|.|.|:|..:  .:.|.|....|...::.:..||::.:..||.:..|:   :.|:
Zfish   928 NNEDLFSESYERVGVMFASIPGFSDYYEKKELIHQDVECLRLLNEIIADFDELLDEPYFQDIEKI 992

  Fly   538 ETVGMVYMAVSG-APDVNPLHAE--HACDLAL------RVMKKFKAHDMGDVAIRVGINSGPVVA 593
            :|:|..|||.|| :|:......|  |...|.|      ..:|:.......|..:||||:.|||||
Zfish   993 KTIGSCYMAASGLSPEKQECEDEWAHLSTLVLFALAMQETLKEINKRTSNDFWLRVGISHGPVVA 1057

  Fly   594 GVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKG----KG 654
            ||:|...|:|.::|.|||.||||:|:....:||:.:.|...:.:.|:.::.||.:.|||    :|
Zfish  1058 GVIGATKPQYDIWGMTVNLASRMDSTGLSGRIQVPEATSRVLAEHGFMLQLRGEIYVKGVSERRG 1122

  Fly   655 DMETYWL 661
            .:.||::
Zfish  1123 AVRTYFV 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 18/62 (29%)
CYCc 457..643 CDD:214485 66/204 (32%)
Guanylate_cyc 485..662 CDD:278633 63/195 (32%)
si:ch211-132f19.7XP_688903.4 AC_N <133..375 CDD:292831
CYCc 338..537 CDD:214485
Guanylate_cyc 381..559 CDD:278633
DUF1053 579..667 CDD:283888
CYCc 903..1103 CDD:214485 65/199 (33%)
Guanylate_cyc 932..1131 CDD:278633 63/198 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.