DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and adcy2b

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_005170095.1 Gene:adcy2b / 557902 ZFINID:ZDB-GENE-060503-69 Length:1142 Species:Danio rerio


Alignment Length:292 Identity:82/292 - (28%)
Similarity:152/292 - (52%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 LIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQ 459
            ::::|..:..|.|::..:....|:|:.     ::..:|:.::.      ::.:|..|..::.:..
Zfish   849 VLKDLKTMGSISLFIFFVTLLVLARQN-----EYYCRLDFLWR------NKFKKECEEIETMENL 902

  Fly   460 GDELLYSMIPRPIAE----RMRLSEEQVCQSFEEVSVIFLEV---MNVYDEGLNSIQGAMQTVNT 517
            ...||.:::|..:||    |...:|:...||::.|.|:|..:   ...|.|...:.:| ::.:..
Zfish   903 NRVLLENVLPAHVAEHFLGRNWKNEDLYHQSYDTVCVMFASIPDFKEFYTESDVNKEG-LECLRL 966

  Fly   518 LNKVFSALDEEIISP---FVYKVETVGMVYMAVSGAPDVNP------------LHAEHACDLALR 567
            ||::.:..||.:..|   .|.|::|:|..|||.:|. :|.|            :|.....:.|..
Zfish   967 LNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGL-NVTPGLEYAQYHDRQYMHIGTMVEFAFA 1030

  Fly   568 VMKK---FKAHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSK 629
            ::.|   ...|...|..:|||||.|||:|||:|.:.|:|.::|:|||.||||||:....|||:::
Zfish  1031 LVGKLDVINKHSFNDFRMRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTE 1095

  Fly   630 YTGDKVRQVGYKVESRGTVQVKGKGDMETYWL 661
            .|...::.:||....||.:.||||||:.|:::
Zfish  1096 ETNWILQTLGYMCSCRGIINVKGKGDLRTFFV 1127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 13/84 (15%)
CYCc 457..643 CDD:214485 65/210 (31%)
Guanylate_cyc 485..662 CDD:278633 67/198 (34%)
adcy2bXP_005170095.1 AC_N <80..307 CDD:292831
CYCc 283..486 CDD:214485
Guanylate_cyc 328..512 CDD:278633
DUF1053 542..646 CDD:283888
CYCc 899..1106 CDD:214485 63/208 (30%)
Guanylate_cyc 929..1128 CDD:278633 67/201 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.