DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and ACXA

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster


Alignment Length:298 Identity:79/298 - (26%)
Similarity:126/298 - (42%) Gaps:75/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 CSKLEIMFEKEEQR----------SDELEKSLELADSWKRQGDELLYSMIPRPIAERMRLS---- 479
            |..|..|:.||.|.          :.:|:...:.||...:....||.:::|..:.| :.||    
  Fly   793 CMMLITMYAKERQSEFNTKMNYKLNLDLQNKQKSADVTNQSIIILLNNILPSHVVE-VYLSSIAK 856

  Fly   480 EEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPF-----VYKVET 539
            .|...:::..|||:|..:.|        .|..:.::..||.:.:|.| .::|.:     |.|::.
  Fly   857 HELYYENYRMVSVMFAMLTN--------FQMDLPSLRVLNDIITAFD-RLLSAYKQYYVVEKIKV 912

  Fly   540 VGMVYMAVSGA---------------------------------------PDVNPLHAEHACDL- 564
            ||..|||..|.                                       .:|..:.|..|.|| 
  Fly   913 VGCTYMAACGLDFSLIENLDSNSNFGSTSLSSELEQVRSRLESSIKEKNHDEVAFIMATFALDLM 977

  Fly   565 -ALRVMKKFKAHDMGDVA-----IRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPW 623
             .|.|..|..|.:..|.|     ||:||::|.::|||||...|.|.::|:.||.||||||:....
  Fly   978 RVLSVCNKAYAGEPFDRALSTGEIRIGISTGQIMAGVVGASQPHYDIWGNPVNMASRMESTGLSG 1042

  Fly   624 KIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWL 661
            .||::|.|...:.:.......||...|||:|::.||::
  Fly  1043 HIQVTKETAQTLEEFDVMCYYRGLTFVKGRGEIPTYFV 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 13/56 (23%)
CYCc 457..643 CDD:214485 62/240 (26%)
Guanylate_cyc 485..662 CDD:278633 63/228 (28%)
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 62/233 (27%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 63/229 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.