DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and ACXE

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster


Alignment Length:298 Identity:74/298 - (24%)
Similarity:129/298 - (43%) Gaps:80/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 CSKLEIMFEKEEQRSDELEKSLELADSWK---RQGDE-----------LLYSMIPRPIAE---RM 476
            |....|||.||.|    :|.:.::..:|:   |:.:.           :|.:::|..|.:   ..
  Fly   785 CITFLIMFVKERQ----IEFTNKVNFNWRVDLRKEENAASLTNHSIIIILNNILPSHIVDVYLNS 845

  Fly   477 RLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFVY----KV 537
            ....|...:::..|||:|..::| ::..|.|::       .||::.:..|..::....|    |:
  Fly   846 LAKHELYFENYRMVSVMFAMLIN-FEMDLRSLR-------VLNEIIAEFDTLLLFYKEYYTVEKI 902

  Fly   538 ETVGMVYMAVSGAPDVN--------------P-------------------------LHAEHACD 563
            :.||..|||..|. |:|              |                         :...:|.|
  Fly   903 KIVGCTYMAACGL-DLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNEDLDEVVFVMTSYALD 966

  Fly   564 LALRVMKKFKAH-------DMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSD 621
            :...:.|..:|:       ::.|..|.:||:||.|:||:||...|.|.::|:.||.||||||:..
  Fly   967 MMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIWGNPVNMASRMESTGL 1031

  Fly   622 PWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETY 659
            |..|.:::.|.:.::|.|.....||...|||:|.:.||
  Fly  1032 PGHIHVTEETSEILQQFGITCSYRGMTFVKGRGKIPTY 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 13/63 (21%)
CYCc 457..643 CDD:214485 57/252 (23%)
Guanylate_cyc 485..662 CDD:278633 60/225 (27%)
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 60/228 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.