DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and CG10738

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:250 Identity:95/250 - (38%)
Similarity:143/250 - (57%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 QHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVS 491
            ::.:.||.:.   :.|:|:|::.       |::.|.||:.|:||.:|::::...:...:.:|:||
  Fly   868 KYANNLEALV---DDRTDQLQEE-------KKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVS 922

  Fly   492 VIFLEVMNVYDEGLNSIQG---AMQTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDV 553
            :.|.:::     |..::..   .:|.|:.||.:::..|..|....||||||:|..||.|||.|..
  Fly   923 IYFSDIV-----GFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLR 982

  Fly   554 N-PLHAEHACDLALRVMK-----KFKAHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNT 612
            | .|||.....::|.::.     |.:......:.:|:||:||||.|||||.|:||||||||||||
  Fly   983 NGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT 1047

  Fly   613 ASRMESSSDPWKIQLSKYTGDKVRQV-----GYKVESRGTVQVKGKGDMETYWLL 662
            |||||||..|.||..|.    :.||:     ||....||.:.:|||||..|||||
  Fly  1048 ASRMESSGVPLKIHCSW----QCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLL 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 13/48 (27%)
CYCc 457..643 CDD:214485 78/199 (39%)
Guanylate_cyc 485..662 CDD:278633 80/190 (42%)
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 13/48 (27%)
CYCc 886..1078 CDD:214485 78/207 (38%)
Guanylate_cyc 913..1099 CDD:278633 81/194 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.