DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and CG32301

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster


Alignment Length:301 Identity:64/301 - (21%)
Similarity:120/301 - (39%) Gaps:97/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 LEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERM---RLSEEQVCQSFEEVSVI 493
            :.:.|||:.:.:....:::::          ::.:::|..:||..   |.|::...::|.:|:|:
  Fly   798 MSMCFEKKHELTKVKTRTIKI----------IMANILPTHVAEVFKVRRRSDQLYYENFSQVAVM 852

  Fly   494 FLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIIS-PFVYKVETV---GMVYMAVSGAPDVN 554
            |..:.| |:...:.::       .|:::....||.::: ...||:|.:   |..|:|..|     
  Fly   853 FATIEN-YEADKSGLR-------ALHEMICYFDELLVNYQSWYKIEKIKVMGWTYLAACG----- 904

  Fly   555 PLHAEHACDLALRV-----MKKFKAHDMGDV---------------------------------- 580
             ||.:|..|.::.|     .:..|....|.|                                  
  Fly   905 -LHVDHYTDFSVSVPISTNRESDKLQKSGSVRFAPMDGDEIMIKDLHPTQATTNEDDNTILVMTE 968

  Fly   581 ---------------------------AIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMES 618
                                       ::::||..|||:|||||...|.|.::|.|||.||||.|
  Fly   969 FALNLLRILRDIRSKGIFFEKDSKLTGSLKIGIAHGPVMAGVVGLSKPHYDIWGHTVNMASRMTS 1033

  Fly   619 SSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETY 659
            :.....|.:::.|.:.:|....:...||...|||.|.:.||
  Fly  1034 TGVRDGIHVTESTANVLRDFNIRCTYRGMTFVKGVGQVPTY 1074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 6/43 (14%)
CYCc 457..643 CDD:214485 53/258 (21%)
Guanylate_cyc 485..662 CDD:278633 56/245 (23%)
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850
CYCc 812..1051 CDD:214485 52/262 (20%)
Nucleotidyl_cyc_III 841..1076 CDD:299850 56/248 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.