DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and ACXD

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster


Alignment Length:444 Identity:94/444 - (21%)
Similarity:164/444 - (36%) Gaps:160/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 SARED--EIDPATGERRSSQGLRSILLKGQM--------------FYIKDVDSLIFLCSPLIENL 399
            |:.||  ::||...||  .|.....:|...|              |.||...|.:.:....:..:
  Fly   722 SSDEDYADLDPTYDER--VQCFHPWILTNCMTLVIGMSFLFTRIPFIIKSCFSALIMIGYAVLVV 784

  Fly   400 DELHGIGLYLN----DLNPHGLSRELVMAGWQHCSKLEI---MFEKEEQRSDELEKSLELADSWK 457
            .|.:.|  |.|    ::|        ..|.:.|...:.|   :|...|::::.:.|   :..:||
  Fly   785 SEFNFI--YANSPSTNVN--------FNAKYSHILLMIITFGIFHLMERQTEFIAK---VDYNWK 836

  Fly   458 RQ-----------GDE---LLYSMIPRPIAE---RMRLSEEQVCQSFEEVSVIFLEVMNVYDEGL 505
            ||           .|.   ||.:::|..:|:   ..:|..|...:.::.|:|:|..:.|...:.:
  Fly   837 RQLIKKQEDALITNDTIKVLLTNILPTHVADFYLSNQLQNELYYEEYDNVAVMFASIKNFDTDKI 901

  Fly   506 NSIQGAMQTVNTLNKVFSALDEEIISPF-----VYKVETVGMVYMAVSG---------------- 549
            .        :..||::....| ::::.:     |.|::.....|||..|                
  Fly   902 G--------LRVLNEIICDFD-DVLNKYSQSLRVEKIKVANWTYMAACGLDVSRSEQVNAPQMKF 957

  Fly   550 ------------------------------------------------------APDVNPLH--- 557
                                                                  .|.::..|   
  Fly   958 RNVSLMPNGRRSRYDGARSSNADGVQRVPYGNGSNIALDLDLERGQYEGNVITSGPRISSTHNGS 1022

  Fly   558 ---------AEHACDLALRVMKKFKAHDM-----GDV---AIRVGINSGPVVAGVVGQKVPRYCL 605
                     ||.|.|| :|.|::|...:|     |..   .:|:||:.|..:|||||...|.|.:
  Fly  1023 SSNEVVRVMAEFALDL-MRTMRRFNTENMQTEYEGSTDYGMLRIGISHGRAMAGVVGISKPHYDI 1086

  Fly   606 FGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETY 659
            :|:.||.||||:|:..|.:||:::.|..|:|:...:...||...|||:|::.||
  Fly  1087 WGNPVNMASRMDSTGVPGQIQVTENTALKLREFNIQCNYRGMTFVKGRGNIPTY 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 34/164 (21%)
CYCc 457..643 CDD:214485 60/297 (20%)
Guanylate_cyc 485..662 CDD:278633 58/270 (21%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 55/270 (20%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 58/273 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.