DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and CG3216

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster


Alignment Length:315 Identity:105/315 - (33%)
Similarity:166/315 - (52%) Gaps:57/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 ERRSSQGLRS---ILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMA 424
            ||.:...:||   .::||             .|..|:::|         ||.:.           
  Fly   868 ERPTFSTIRSNIRTIMKG-------------FCENLMDDL---------LNRME----------- 899

  Fly   425 GWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEE 489
              |:.:.||.:.|::.:     :.|||     |::.:||||.::|||:|:::...:....:.|..
  Fly   900 --QYANNLESLVEEKTR-----QLSLE-----KQRTEELLYQILPRPVAQQLMAGDLVEPEEFSS 952

  Fly   490 VSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN 554
            |::.|.:::...:  |.:....|..||.||.::|..|..|....||||||:|..|:.|||.|:.|
  Fly   953 VTIYFSDIVGFTE--LCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPN 1015

  Fly   555 -PLHAEHACDLALRVMKKFKAHDMG-----DVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTA 613
             ..||.....:||.:::...:.::.     .:.||:|::||.|.|||||:|:|.|||||||||||
  Fly  1016 GDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTA 1080

  Fly   614 SRMESSSDPWKIQLSKYTGDKVRQVG-YKVESRGTVQVKGKGDMETYWLLEGPEG 667
            |||||:..|.||.:|..|...:.:.| :::|.||.|::||||.:.||||....||
  Fly  1081 SRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSEG 1135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 27/115 (23%)
CYCc 457..643 CDD:214485 73/192 (38%)
Guanylate_cyc 485..662 CDD:278633 75/183 (41%)
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 4/16 (25%)
TyrKc 627..877 CDD:197581 2/8 (25%)
HNOBA <882..939 CDD:285003 23/101 (23%)
CYCc 918..1109 CDD:214485 75/197 (38%)
Guanylate_cyc 945..1131 CDD:278633 76/187 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.