DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and rut

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:303 Identity:97/303 - (32%)
Similarity:159/303 - (52%) Gaps:42/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 DSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSL 450
            |:.:....||  :|..|..|.:::..:..||   .||    :..::|:.:::.  |.|.|.::..
  Fly   868 DNRVNASIPL--HLISLARIAIFMIAILVHG---RLV----EGTARLDFLWQL--QASQEKKEMD 921

  Fly   451 ELADSWKRQGDELLYSMIPRPIA-----ERMRLSEEQVCQSFEEVSVIFLEVMN---VYDEGLNS 507
            .|.:|.||    :|::::|..:|     .:.|.:.|...||:.:|.|||..|.|   .|.|...|
  Fly   922 VLQESNKR----ILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGS 982

  Fly   508 IQGAMQTVNTLNKVFSALDE---EIISPFVYKVETVGMVYMAVSG--------APDVNPLHAEHA 561
            .|| ::.:..||::.:..||   |.....:.|::|||..||||.|        ..|.|.:. .|.
  Fly   983 DQG-LECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVR-RHM 1045

  Fly   562 CDL-----ALR-VMKKFKAHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSS 620
            ..|     |:| .:::..:|...:..:|||||.|||||||:|.:.|:|.::|:|||.||||:|:.
  Fly  1046 TALIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTG 1110

  Fly   621 DPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWLLE 663
            .|...|:::...|.:....::...|||::|||||||.||:|.:
  Fly  1111 VPGYSQVTQEVVDSLVGSHFEFRCRGTIKVKGKGDMVTYFLCD 1153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 21/94 (22%)
CYCc 457..643 CDD:214485 68/210 (32%)
Guanylate_cyc 485..662 CDD:278633 73/196 (37%)
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 6/26 (23%)
CYCc 924..1134 CDD:214485 69/215 (32%)
Guanylate_cyc 954..1151 CDD:278633 73/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.