DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and Adcy10

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_766617.2 Gene:Adcy10 / 271639 MGIID:2660854 Length:1614 Species:Mus musculus


Alignment Length:238 Identity:61/238 - (25%)
Similarity:100/238 - (42%) Gaps:48/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 FLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELAD 454
            ||..|...|.||.....:...|..|.|..:..:        :|..|.|.:    .|||.||:   
Mouse   217 FLKPPPTFNFDEFFTKCMGFMDYYPSGDHKNFL--------RLACMLESD----PELELSLQ--- 266

  Fly   455 SWKRQGDELLYSMIPRPIAE---RMRLSEEQVCQSFEEVSVIFLEVMNVYDEGL----NSIQGAM 512
                   :.:..:|.:.|.:   |..|||      ...|:::|:.:|....:.:    ::||.|.
Mouse   267 -------KYVMEIILKQIDDKQLRGYLSE------LRPVTIVFVNLMFKEQDKVEVIGSAIQAAC 318

  Fly   513 QTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAP-DVNPLHAEHACDLALRVMKKF--KA 574
            ..:.::.|||..   :|...|::   ..|..::.|.|.| :..|....||.:.|:.:. .|  :.
Mouse   319 VHITSVLKVFRG---QINKVFMF---DKGCSFLCVFGFPGEKAPDEITHALESAVDIF-DFCSQV 376

  Fly   575 HDMGDVAIRVGINSGPVVAGVVGQKV-PRYCLFGDTVNTASRM 616
            |.:..|:|  |:.||.|..|:||..| ..|.:.|..||.|:||
Mouse   377 HKIRTVSI--GVASGIVFCGIVGHTVRHEYTVIGQKVNIAARM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 19/88 (22%)
CYCc 457..643 CDD:214485 44/171 (26%)
Guanylate_cyc 485..662 CDD:278633 38/140 (27%)
Adcy10NP_766617.2 CHD 40..214 CDD:143636
CHD 292..461 CDD:143636 38/135 (28%)
COG3899 485..>959 CDD:226415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.