DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and Gucy1a2

DIOPT Version :10

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001028494.1 Gene:Gucy1a2 / 234889 MGIID:2660877 Length:730 Species:Mus musculus


Alignment Length:72 Identity:14/72 - (19%)
Similarity:28/72 - (38%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 GLFQSADLLLHETNGILMTYGPYAEDGHISPQSNIAFHTNLKAEDPEHGLKDIKYLERLANSSNL 185
            |:|:|..|....|..:...:..:       ||..:.|.|..:..  :.|....|.::|.....|.
Mouse    92 GIFKSVKLCAAITQDLRELHRSF-------PQMKMVFSTITQRH--KWGSLHPKKIDRARRFINS 147

  Fly   186 RLAEKIT 192
            .:|:.::
Mouse   148 MMAKSVS 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:462233 9/39 (23%)
HNOBA 218..476 CDD:462234
Nucleotidyl_cyc_III 485..662 CDD:448371
Gucy1a2NP_001028494.1 HNOB <157..268 CDD:462233
HNOBA 314..501 CDD:462234
Guanylate_cyc 512..696 CDD:425528
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.