DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and PHLPP1

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_919431.2 Gene:PHLPP1 / 23239 HGNCID:20610 Length:1717 Species:Homo sapiens


Alignment Length:589 Identity:109/589 - (18%)
Similarity:185/589 - (31%) Gaps:225/589 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CFVRFFS----NFGYDKMIRSTGRYFCDFLQSIDNIHLIMRFTYPKMKSPSMQL-TNMDDNGAVI 131
            |.:||::    :.|..:.|:.:|.|                    .::...||| .|......||
Human   519 CLIRFYAGKPHSTGSSERIQLSGMY--------------------NVRKGKMQLPVNRWTRRQVI 563

  Fly   132 L---------YRSSRTGMSKY--LIGQMTEVAREFYGLEIKAYVIESQNDISGGTAGPIKLTDGP 185
            |         .:.|.||....  |||...|        |:|.:    |:.::..::||...|   
Human   564 LCGTCLIVSSVKDSLTGKMHVLPLIGGKVE--------EVKKH----QHCLAFSSSGPQSQT--- 613

  Fly   186 LTVIVKYRLDFDN-REYM--AKRVNTEAHPSQLKMPTVKLD-VFLDLFPFTFVLNHDMKITHAGE 246
                  |.:.||. .||:  .::|:..|  || ::.:|.|. ..|:..|.....:.|  :||...
Human   614 ------YYICFDTFTEYLRWLRQVSKVA--SQ-RISSVDLSCCSLEHLPANLFYSQD--LTHLNL 667

  Fly   247 KIVETWIMHNPGANPKSFIGTHVMDLFQCRRPKDTTIDWDTLIQMRAVLFEFELIRTGHNRAAYD 311
            |  :.::..||                             :|...|.                  
Human   668 K--QNFLRQNP-----------------------------SLPAARG------------------ 683

  Fly   312 AVLNMDFENYDEMDLNEAQTMALAKAQEFSESH----PVDDDESAREDEIDPATGERRS------ 366
                          |||.|.....|:...|.:|    |:.........|::.:....||      
Human   684 --------------LNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELNVSCNALRSVPAAVG 734

  Fly   367 -SQGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLN--PHGLSR-----ELVM 423
             ...|::.||.|........:         :||:.:|..:||..|:..  |..|.:     :|.|
Human   735 VMHNLQTFLLDGNFLQSLPAE---------LENMKQLSYLGLSFNEFTDIPEVLEKLTAVDKLCM 790

  Fly   424 AG-------------WQHCSKLEIMFEK-EEQRSDELE-----KSLELADSWKRQGDELLYSMIP 469
            :|             ..|...:::.... .:..:||::     ..|:|.|:.....|.::::.|.
Human   791 SGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRDNKLGDLDAMIFNNIE 855

  Fly   470 RPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFV 534
            ....||.:|....:|..|                               .|...|...|::...|
Human   856 VLHCERNQLVTLDICGYF-------------------------------LKALYASSNELVQLDV 889

  Fly   535 YKVETVGMVYMAVSGAPDVNPLH--AEHACDLALRVMKKFKAHDMG-----DVAIRVGINSG--P 590
            |.|... :.||.||.    |.|.  .|..|:     .:|.:..|:|     ::..|:..||.  .
Human   890 YPVPNY-LSYMDVSR----NRLENVPEWVCE-----SRKLEVLDIGHNQICELPARLFCNSSLRK 944

  Fly   591 VVAG 594
            ::||
Human   945 LLAG 948

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002 22/104 (21%)
HNOBA 218..476 CDD:285003 47/295 (16%)
CYCc 457..643 CDD:214485 29/147 (20%)
Guanylate_cyc 485..662 CDD:278633 23/119 (19%)
PHLPP1NP_919431.2 leucine-rich repeat 1107..1129 CDD:275380
PP2Cc 1168..1420 CDD:214625
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1458..1510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1673..1717
PDZ-binding, required for interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1715..1717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..470
PH_PHLPP-like 535..631 CDD:270131 28/136 (21%)
PH 555..636 CDD:278594 24/103 (23%)
LRR_RI 625..929 CDD:238064 72/421 (17%)
LRR_8 638..703 CDD:290566 18/129 (14%)
LRR 1 638..659 4/20 (20%)
leucine-rich repeat 641..661 CDD:275380 4/19 (21%)
LRR 2 661..682 7/53 (13%)
leucine-rich repeat 662..692 CDD:275380 11/92 (12%)
LRR 3 692..712 4/19 (21%)
leucine-rich repeat 693..738 CDD:275380 7/44 (16%)
LRR_8 714..770 CDD:290566 12/64 (19%)
LRR 4 715..736 3/20 (15%)
LRR 5 738..760 6/30 (20%)
leucine-rich repeat 739..761 CDD:275380 6/30 (20%)
LRR 6 761..783 6/21 (29%)
leucine-rich repeat 762..784 CDD:275380 6/21 (29%)
LRR 7 784..804 3/19 (16%)
leucine-rich repeat 785..808 CDD:275380 3/22 (14%)
LRR 8 808..831 3/22 (14%)
leucine-rich repeat 810..832 CDD:275380 2/21 (10%)
LRR_RI 814..1074 CDD:238064 34/176 (19%)
LRR 9 832..853 4/20 (20%)
leucine-rich repeat 833..853 CDD:275380 4/19 (21%)
leucine-rich repeat 854..895 CDD:275380 12/71 (17%)
LRR 10 873..894 7/51 (14%)
LRR 11 895..916 8/30 (27%)
leucine-rich repeat 896..918 CDD:275380 8/30 (27%)
LRR 12 918..939 4/20 (20%)
leucine-rich repeat 919..941 CDD:275380 4/21 (19%)
LRR 13 941..962 2/8 (25%)
leucine-rich repeat 942..963 CDD:275380 2/7 (29%)
LRR_8 962..1024 CDD:290566
LRR 14 963..984
leucine-rich repeat 964..987 CDD:275380
LRR 15 987..1008
leucine-rich repeat 988..1011 CDD:275380
LRR 16 1013..1033
LRR_8 1014..1072 CDD:290566
leucine-rich repeat 1014..1037 CDD:275380
LRR 17 1037..1058
leucine-rich repeat 1038..1061 CDD:275380
LRR 18 1061..1082
Interaction with SLC9A3R1. /evidence=ECO:0000269|PubMed:21804599 1076..1205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.