DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and gcy-5

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_496219.1 Gene:gcy-5 / 191643 WormBaseID:WBGene00001532 Length:1122 Species:Caenorhabditis elegans


Alignment Length:283 Identity:109/283 - (38%)
Similarity:156/283 - (55%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 PLIENLDELHGIGLYLNDLNPHG---LSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADS 455
            |..|.:.:|      |:::.|.|   |...:.....::.|.||:..   |:|:.||  :||    
 Worm   804 PKAEQICKL------LSEMTPRGNTNLMDHVFNMLEEYTSTLEVDI---EERTKEL--TLE---- 853

  Fly   456 WKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNTLNK 520
             |::.|.||..|:|:.:|||::..:....:.|:.|:|:|.:|:....  |.:.....|.||.||.
 Worm   854 -KKKADILLSRMLPKQVAERLKAGQTVEPEGFDTVTVLFSDVVKFTQ--LAAKCSPFQVVNLLND 915

  Fly   521 VFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNP-LHAEHACDLALRVM---KKFKAHDM--GD 579
            ::|..|..|....|||||::|..|:.|||.|..|. .|.:...|::|:.|   |.||...:  ..
 Worm   916 LYSNFDTIIEEHGVYKVESIGDGYLCVSGLPTKNGYAHIKQIVDMSLKFMDYCKSFKVPHLPREK 980

  Fly   580 VAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSK-----YTGDKVRQVG 639
            |.:|:||||||.||||||..:||||||||||||||||||:..|..|.:|:     .|.....|  
 Worm   981 VELRIGINSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSMIHMSEAAHSLLTDHYPHQ-- 1043

  Fly   640 YKVESRGTVQVKGKGDMETYWLL 662
            |:..|||.|.:||||.|||:|:|
 Worm  1044 YETSSRGEVIIKGKGVMETFWVL 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 24/84 (29%)
CYCc 457..643 CDD:214485 80/196 (41%)
Guanylate_cyc 485..662 CDD:278633 83/187 (44%)
gcy-5NP_496219.1 PBP1_NPR_GC_like 30..440 CDD:107347
ANF_receptor 49..426 CDD:279440
PK_GC 546..816 CDD:270894 4/17 (24%)
HNOBA <830..873 CDD:285003 17/52 (33%)
CYCc 852..1042 CDD:214485 80/196 (41%)
Guanylate_cyc 879..1067 CDD:278633 84/192 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.