DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and gcy-20

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_507101.1 Gene:gcy-20 / 184797 WormBaseID:WBGene00001545 Length:1108 Species:Caenorhabditis elegans


Alignment Length:240 Identity:95/240 - (39%)
Similarity:141/240 - (58%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDE 503
            ||:.||   ::.||.:. |::.|.|||.|:||.:|::::|.:....::||:|::.|.:|:.    
 Worm   828 EEEVSD---RTKELTEE-KKKSDVLLYRMLPRMVADKLKLGQTVEPETFEQVTIFFSDVVQ---- 884

  Fly   504 GLNSIQG---AMQTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPL-HAEHACDL 564
             ..::.|   .:|.|..||.:::..|..|....||||||:|..|:.|||.|..|.. |..|...:
 Worm   885 -FTTLAGKCTPLQVVTLLNDLYTIFDGIIEQNDVYKVETIGDGYLCVSGLPHRNGNDHIRHIARM 948

  Fly   565 ALRVMKK---FKAHDM--GDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWK 624
            :|..:..   |:...:  ..:.:|:|||.|.|||||||..:||||||||.|||||||||:..|.:
 Worm   949 SLGFLSSLEFFRVQHLPAERINLRIGINCGSVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPGQ 1013

  Fly   625 IQLSKYTGDKVRQV--GYKVESRGTVQVKGKGDMETYWLLEGPEG 667
            |.::......:.||  |::.||||.|.:||||.|||:|||....|
 Worm  1014 IHVTAEANRMLTQVVGGFRTESRGEVIIKGKGVMETFWLLGEESG 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 15/36 (42%)
CYCc 457..643 CDD:214485 73/196 (37%)
Guanylate_cyc 485..662 CDD:278633 76/187 (41%)
gcy-20NP_507101.1 PBP1_NPR_GC_like 22..439 CDD:107347
ANF_receptor 44..418 CDD:279440
PKc_like 536..801 CDD:304357
STYKc 562..801 CDD:214568
HNOBA <818..861 CDD:285003 15/36 (42%)
CYCc 840..1032 CDD:214485 73/197 (37%)
Guanylate_cyc 867..1054 CDD:278633 77/191 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.