DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and gcy-18

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:311 Identity:100/311 - (32%)
Similarity:154/311 - (49%) Gaps:43/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 YIKDVDSLIFLCSPLIENLDELH-GIGLYLNDL---NPH--------GLSRELVMAGWQHCSKLE 433
            |:.|....:   ||.|:|...|| .:...|.|.   ||.        .|:.|:|:.  ...|.::
 Worm   797 YLADGSKTV---SPEIQNQMGLHPDLNALLRDCWSENPEIRPSIRRVRLNTEMVLK--TKGSLVD 856

  Fly   434 IMFEKEEQRSDELEK-------SLELADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVS 491
            .|.:..||.::.|||       .||.|:.   :.|:||..::|..:|..:::......:.:...:
 Worm   857 QMMKMMEQYANNLEKLVAERTGMLEEANI---RADQLLTQLLPAYVANELKMGRSVAPKLYSSAT 918

  Fly   492 VIFLEVMNVYDEGLNSI-QGA--MQTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDV 553
            ::|.:::     |..:| .|:  ::.||.||.:::..||.|.....|||||:|..||.|||.|:.
 Worm   919 ILFSDIV-----GFTTICSGSTPLEVVNMLNGLYTGFDECITRNKSYKVETIGDAYMVVSGIPEE 978

  Fly   554 NPL-HAEHACDLALRVMKKFKAHDMGD-----VAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNT 612
            |.. |:.:..:.||.:.:....:.:..     |..|.|.::|.|.|||||...|||||||||||.
 Worm   979 NEYNHSRNIANTALDMRQYLTGYQIPHRPTHRVRCRWGFHTGSVAAGVVGLTCPRYCLFGDTVNV 1043

  Fly   613 ASRMESSSDPWKIQLSKYTGDKVR--QVGYKVESRGTVQVKGKGDMETYWL 661
            :|||||:..|..||:|:.....:|  ...:....||.|||||||...|:||
 Worm  1044 SSRMESTGTPGMIQMSEEAHMHIRAHHPVFTTTERGEVQVKGKGTCRTFWL 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 30/113 (27%)
CYCc 457..643 CDD:214485 63/196 (32%)
Guanylate_cyc 485..662 CDD:278633 70/188 (37%)
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141
ANF_receptor 87..395 CDD:279440
PKc_like 549..846 CDD:304357 13/51 (25%)
HNOBA <857..903 CDD:285003 14/48 (29%)
CYCc 882..1073 CDD:214485 64/198 (32%)
Guanylate_cyc 909..1095 CDD:278633 70/191 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.