DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and acy-1

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_497970.1 Gene:acy-1 / 175622 WormBaseID:WBGene00000068 Length:1253 Species:Caenorhabditis elegans


Alignment Length:363 Identity:102/363 - (28%)
Similarity:160/363 - (44%) Gaps:77/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 EFSESHPVDDDESAREDE--IDP------------ATGERRSSQGLRSILLKGQMFYIKDVDSLI 389
            ||:..|.|::.::.....  |.|            :|..|..||               |..|.:
 Worm   919 EFNLKHLVEEQDTCNVTAIMIPPIRKGLNYTIALNSTSARTLSQ---------------DFGSPL 968

  Fly   390 FLCSPLIENLDELHGIGL--YLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLEL 452
            |:...|   ||.:..|.|  :||               :|..:...:.|..:.|...:.|:...:
 Worm   969 FIWELL---LDVILSIVLVAFLN---------------YQFETAFRMSFFGDVQARRDTERMQIV 1015

  Fly   453 ADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVSVIFLEVMNVYDEGLNSIQGAMQTVNT 517
            .|    |.|.||.::||....|.:: ::.:..::.|.|.|:|..:.|..|....:.:|..:.:..
 Worm  1016 RD----QADWLLNNVIPAHAVESLK-TDTKYSENHETVGVLFASITNWNDMYEENFEGGREFLRV 1075

  Fly   518 LNKVFSALDEEIISP---FVYKVETVGMVYMAVSGAPDVNP------LH-AEH---ACDLALRVM 569
            ||:|....||.:..|   .:.|::|:|..|||.||   :||      || .||   ..|.||.|.
 Worm  1076 LNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASG---LNPERKKNMLHPKEHLYQMVDFALAVQ 1137

  Fly   570 KKFKAHDMG----DVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKY 630
            ......:..    |...::|:|.|||.|||:|.....|.::|||||.||||.|:....:||:|::
 Worm  1138 HVLSVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVSQH 1202

  Fly   631 TGDKVRQVGYKVESRGTVQVKG-KGDMETYWLLEGPEG 667
            |.:.:.. .|:.|.|..::||| .|.|:|| ||.|.:|
 Worm  1203 TREYLLD-RYEFEFRDHIEVKGIDGGMDTY-LLVGRKG 1238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 32/152 (21%)
CYCc 457..643 CDD:214485 64/202 (32%)
Guanylate_cyc 485..662 CDD:278633 66/194 (34%)
acy-1NP_497970.1 MreD 127..>223 CDD:294686
CYCc 297..469 CDD:214485
Guanylate_cyc 317..503 CDD:278633
SDF <773..982 CDD:294387 16/80 (20%)
CYCc 1016..1215 CDD:214485 65/207 (31%)
Guanylate_cyc 1041..1235 CDD:278633 68/198 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.