DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and gcy-29

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:243 Identity:76/243 - (31%)
Similarity:126/243 - (51%) Gaps:16/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 LEIMFEKEEQRSDELEKSL----ELADSWKRQGDELLYSMIPRPIAERMRLSEEQVCQSFEEVSV 492
            ::.|....|:.::.|||.:    :||:....:.:.||:.::|:.:|..::.......:.::..:|
 Worm   813 VDSMMRMMEEYANNLEKLVGERTKLAEEANLRAERLLFQLLPKHVAIELKAGRTVAPKMYDSATV 877

  Fly   493 IFLEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN-PL 556
            :|.:::..  ..|.|....::.||.|||::|..|..|.....|||||:|..||.|||.|..| ..
 Worm   878 MFSDIVGF--TKLCSASTPIEVVNLLNKLYSEFDTVISKHDCYKVETIGDAYMVVSGIPIENGQR 940

  Fly   557 HAEHACDLALRVMKKFKAHDMGD-----VAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRM 616
            |..:...:.|.:|...|..::..     :.||:|..||.|.|.|||...|||||||:|||.|:.|
 Worm   941 HVANISAVTLGIMDLLKVFEVPHRRDYRLTIRLGFASGQVSAAVVGLSSPRYCLFGETVNIAAVM 1005

  Fly   617 ESSSDPWKIQLSKYTGDKVRQVGYK---VESRGTVQVKGKGDMETYWL 661
            |||.:..::|::: |...:.:..|.   :|.||..:...:.|..||||
 Worm  1006 ESSGEGGRVQITE-TSKILLENEYPEFIIEIRGINKDVKQDDFVTYWL 1052

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 11/47 (23%)
CYCc 457..643 CDD:214485 61/194 (31%)
Guanylate_cyc 485..662 CDD:278633 65/186 (35%)
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665
CYCc 840..1033 CDD:214485 61/195 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.