DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and Adcy6

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:368 Identity:112/368 - (30%)
Similarity:178/368 - (48%) Gaps:83/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 FENYDEMDLNEAQTMALAKAQEFSESHPVDDDESAREDEID-PATGERRSSQGLRSILLKGQMFY 381
            |:|||.:    .....||.:.|             ..|.:| ||.|.         :.||    |
Mouse   948 FDNYDLL----LGVHGLASSNE-------------TFDGLDCPAVGR---------VALK----Y 982

  Fly   382 IKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDEL 446
            :..|..|:|             .:.|||:.......:|...:  |    ||:...||||.  :||
Mouse   983 MTPVILLVF-------------ALALYLHAQQVESTARLDFL--W----KLQATGEKEEM--EEL 1026

  Fly   447 EKSLELADSWKRQGDELLYSMIPRPIA----ERMRLSEEQVCQSFEEVSVIFLEVMN---VYDEG 504
            :       ::.|:   ||::::|:.:|    .|.|.::|...||.|.|:|:|..:.|   .|.| 
Mouse  1027 Q-------AYNRR---LLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVE- 1080

  Fly   505 LNSIQGAMQTVNTLNKVFSALDEEIISPFVY----KVETVGMVYMAVSGA-----PDVNPLHAEH 560
            |.:....::.:..||::.:..| ||||...:    |::|:|..|||.||.     ..|...|...
Mouse  1081 LEANNEGVECLRLLNEIIADFD-EIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITA 1144

  Fly   561 ACDLALRVMKKFK---AHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDP 622
            ..|.|:|:|::.|   .|...:..:::|:|.|||||||:|.:.|:|.::|:|||.:|||:|:..|
Mouse  1145 LADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVP 1209

  Fly   623 WKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWLLEGP 665
            .:||::......:...||::|.||.|:|||||:|.||:|..||
Mouse  1210 DRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGP 1252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 36/162 (22%)
CYCc 457..643 CDD:214485 66/204 (32%)
Guanylate_cyc 485..662 CDD:278633 70/191 (37%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454
Guanylate_cyc 456..640 CDD:306677
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677 71/195 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.