DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and ADCY9

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_005255136.1 Gene:ADCY9 / 115 HGNCID:240 Length:1372 Species:Homo sapiens


Alignment Length:334 Identity:93/334 - (27%)
Similarity:153/334 - (45%) Gaps:52/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 RSSQGLRSILLKGQMFYIKDVDSLIFLC---SPLIENLDELHGIGLYLNDLN---PHGLSRELVM 423
            |||  |.:::..|.:..:     .:.||   |.|...||.:.......|..|   |..|.|...:
Human   939 RSS--LATVVGAGPLLLL-----YVSLCPDSSVLTSPLDAVQNFSSERNPCNSSVPRDLRRPASL 996

  Fly   424 AG--------------WQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE 474
            .|              |....:.|:.:........|.:.......|.:.|.|.||.::||..:||
Human   997 IGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAE 1061

  Fly   475 RMRLSEEQVCQSFEEVSVIFLEVMN---VYDEGLNSIQGAMQTVNTLNKVFSALDEEIISP---F 533
            ::::| :...::.:...|||..::|   .|:|   :.:|..:....||::....||.:..|   .
Human  1062 QLKVS-QTYSKNHDSGGVIFASIVNFSEFYEE---NYEGGKECYRVLNELIGDFDELLSKPDYSS 1122

  Fly   534 VYKVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKFKAHDMGDVA-------------IRVG 585
            :.|::|:|..|||.||..........|..: .|:::.:| |.:|..|.             :|||
Human  1123 IEKIKTIGATYMAASGLNTAQAQDGSHPQE-HLQILFEF-AKEMMRVVDDFNNNMLWFNFKLRVG 1185

  Fly   586 INSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQV 650
            .|.||:.|||:|.....|.::|||||.||||:::....:||:|:.:...:.::||..:.||||.|
Human  1186 FNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNV 1250

  Fly   651 KGKGDMETY 659
            ||||.|:||
Human  1251 KGKGQMKTY 1259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 29/130 (22%)
CYCc 457..643 CDD:214485 60/204 (29%)
Guanylate_cyc 485..662 CDD:278633 63/194 (32%)
ADCY9XP_005255136.1 DUF2339 <118..>301 CDD:287113
CYCc 326..544 CDD:214485
Guanylate_cyc 385..573 CDD:278633
CYCc 1043..1243 CDD:214485 60/205 (29%)
Guanylate_cyc 1069..1260 CDD:278633 63/196 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.