DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and ADCY6

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:514 Identity:137/514 - (26%)
Similarity:223/514 - (43%) Gaps:137/514 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 VNTEAHPSQLKMPTVKLDVFLDLFPFTFVLNH----------------DMKITHAGEKIVETWIM 254
            |.:.||.:.:.:.:|.| ||.......|..||                |:...|..:      :.
Human   736 VRSRAHSTAVGIFSVLL-VFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQ------LN 793

  Fly   255 HNPGAN-------------PKSFIGTHVMDLFQCRRPKDTTIDWDTLIQMRAVLFEFELIRTGHN 306
            ::.|.:             |:.|||..::.|.     ..:.....:.|...|::|...||     
Human   794 YSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLL-----ASSVFLHISSIGKLAMIFVLGLI----- 848

  Fly   307 RAAYDAVLNMD-----FENYDEMDLNEAQTMALAKAQEFSESHPVDDDESAREDEID-PATGERR 365
               |..:|.:.     |:|||.:    .....||.:.|             ..|.:| ||.|.  
Human   849 ---YLVLLLLGPPATIFDNYDLL----LGVHGLASSNE-------------TFDGLDCPAAGR-- 891

  Fly   366 SSQGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCS 430
                   :.||    |:..|..|:|             .:.|||:.......:|...:  |    
Human   892 -------VALK----YMTPVILLVF-------------ALALYLHAQQVESTARLDFL--W---- 926

  Fly   431 KLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIA----ERMRLSEEQVCQSFEEVS 491
            ||:...||||.  :||:       ::.|:   ||::::|:.:|    .|.|.::|...||.|.|:
Human   927 KLQATGEKEEM--EELQ-------AYNRR---LLHNILPKDVAAHFLARERRNDELYYQSCECVA 979

  Fly   492 VIFLEVMN---VYDEGLNSIQGAMQTVNTLNKVFSALDEEIISPFVY----KVETVGMVYMAVSG 549
            |:|..:.|   .|.| |.:....::.:..||::.:..| ||||...:    |::|:|..|||.||
Human   980 VMFASIANFSEFYVE-LEANNEGVECLRLLNEIIADFD-EIISEERFRQLEKIKTIGSTYMAASG 1042

  Fly   550 A-----PDVNPLHAEHACDLALRVMKKFK---AHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLF 606
            .     ..|...|.....|.|:|:|::.|   .|...:..:::|:|.|||||||:|.:.|:|.::
Human  1043 LNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIW 1107

  Fly   607 GDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWLLEGP 665
            |:|||.:|||:|:..|.:||::......:...||::|.||.|:|||||:|.||:|..||
Human  1108 GNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGP 1166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 58/296 (20%)
CYCc 457..643 CDD:214485 66/204 (32%)
Guanylate_cyc 485..662 CDD:278633 70/191 (37%)
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454
Guanylate_cyc 370..554 CDD:306677
DUF1053 582..668 CDD:399378
Guanylate_cyc 970..1164 CDD:306677 71/195 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.