DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and ADCY5

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens


Alignment Length:547 Identity:139/547 - (25%)
Similarity:239/547 - (43%) Gaps:136/547 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 IKLTDGPLTVIVKYRLDFDNREYMAKRVNTEAHPSQLKMPTVKLDVFLDLFPFTFVLN------- 236
            :||...||..:.:            |.|.::.:.:.:.:.|:.| |||..|...|..|       
Human   813 VKLFPSPLQTLSR------------KIVRSKMNSTLVGVFTITL-VFLAAFVNMFTCNSRDLLGC 864

  Fly   237 ----HDMKIT-----HAGEKIV------ETWIMHNPGAN---PKSFIGTHVMDLFQCRRPKDTTI 283
                |::..:     |..|..|      |.....:|..|   |:.|..:.::.|..|        
Human   865 LAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNFPEYFTYSVLLSLLAC-------- 921

  Fly   284 DWDTLIQMRAV-----LFEFELIRTGHNRAAYDAVLNMD----FENYDEMDLNEAQTMALAKAQE 339
              ...:|:..:     :...|||        |..::.:.    |:|        |..:..|.|.:
Human   922 --SVFLQISCIGKLVLMLAIELI--------YVLIVEVPGVTLFDN--------ADLLVTANAID 968

  Fly   340 FSESHPVDDD--ESAREDEID-----PATGERRSSQGLRSILLKGQMFYIKDVDSLIFLCSPLIE 397
            |..:......  |:.|...::     |:..:.:|.:....:.||              :.:|:|.
Human   969 FFNNGTSQWSLCENLRHRRMEAGTYFPSGVKEQSPEHATKVALK--------------VVTPIII 1019

  Fly   398 NLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE 462
            ::..|   .|||:.......:|...:  |    ||:...||||.  :||:       ::.|:   
Human  1020 SVFVL---ALYLHAQQVESTARLDFL--W----KLQATEEKEEM--EELQ-------AYNRR--- 1063

  Fly   463 LLYSMIPRPIA----ERMRLSEEQVCQSFEEVSVIFLEVMN---VYDEGLNSIQGAMQTVNTLNK 520
            ||::::|:.:|    .|.|.::|...||.|.|:|:|..:.|   .|.| |.:....::.:..||:
Human  1064 LLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVE-LEANNEGVECLRLLNE 1127

  Fly   521 VFSALDEEIISPFVY----KVETVGMVYMAVSGAPD-----VNPLHAEHACDLALRVMKKFK--- 573
            :.:..| ||||...:    |::|:|..|||.||..|     |...|.:...|.|:::|.:.|   
Human  1128 IIADFD-EIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYIN 1191

  Fly   574 AHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQV 638
            .|...:..:::|:|.|||||||:|.:.|:|.::|:|||.||||:|:..|.:||::......:...
Human  1192 EHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAAN 1256

  Fly   639 GYKVESRGTVQVKGKGDMETYWLLEGP 665
            .|::|.||.|:|||||:|.||:|..||
Human  1257 TYQLECRGVVKVKGKGEMMTYFLNGGP 1283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 57/302 (19%)
CYCc 457..643 CDD:214485 66/204 (32%)
Guanylate_cyc 485..662 CDD:278633 70/191 (37%)
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 71/195 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.