DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and LOC110440024

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_021334171.1 Gene:LOC110440024 / 110440024 -ID:- Length:416 Species:Danio rerio


Alignment Length:275 Identity:56/275 - (20%)
Similarity:108/275 - (39%) Gaps:80/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 TTIDWDTLIQMRAV-LFEFELIRTGHNRAAYDAVLNMDFE-NYDEMDLNEAQTMALAKAQEFSES 343
            |:.|.|:|.|...: |.||    ..|.::....:||..:. |:  .|.|:.....|| .:|...:
Zfish   154 TSTDLDSLGQPCDIELQEF----CDHLQSNLSEMLNATWRGNF--ADANDTTVFTLA-IEEILNT 211

  Fly   344 HPVDDDESAREDEIDPATGERRSS----QGLRSILLKGQMFYIKDVD---------SLIFLCSPL 395
            ..|.|        ||.:..:...:    ..|:.:|...::.|:|.|:         :|:.:...:
Zfish   212 WGVKD--------IDVSLLQHNPTWTDVLALKLLLTAQELNYLKKVENQDEIWQVTALLTVLKDM 268

  Fly   396 IENLDE--LHGIGLYLNDLNPHGL----------SRELVMAGWQHC--------SKLE------- 433
            .|||.:  :..|.:.||..|...|          |.:|.:...|.|        .||:       
Zfish   269 SENLHQCWMENIDVDLNLTNVKDLLYTTSTSSEGSTDLALMNVQRCVHFRAGWSLKLKSRDISSS 333

  Fly   434 -------------------IMFEKEEQRSDELEKSL-ELADSWKRQ---GDELLYSMIPRPIAER 475
                               :.|::..:...:..:|| |..:..||:   .::||:.|:|:.:|::
Zfish   334 ISLKVCLLTIACLIYPIVLLSFKQMTEWIQDYAQSLREKTEDLKRERRLAEDLLHQMLPKSVAKQ 398

  Fly   476 MRLSEEQVCQSFEEV 490
            :|.::....:|:|:|
Zfish   399 LRQNKHFEAESYEKV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 52/259 (20%)
CYCc 457..643 CDD:214485 11/37 (30%)
Guanylate_cyc 485..662 CDD:278633 3/6 (50%)
LOC110440024XP_021334171.1 HNOBA <369..399 CDD:311573 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D531253at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.