DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Da and Adcy4

DIOPT Version :9

Sequence 1:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001348533.1 Gene:Adcy4 / 104110 MGIID:99674 Length:1077 Species:Mus musculus


Alignment Length:270 Identity:82/270 - (30%)
Similarity:140/270 - (51%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 QHCSKLEIMFEK----EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERM----RLSEEQV 483
            ::..:|:.:::|    |.:.::.:|....|          ||.:::|..:|.:.    |.:|:..
Mouse   813 EYYCRLDFLWKKKLRQEREETETMENLTRL----------LLENVLPAHVAPQFIGQNRRNEDLY 867

  Fly   484 CQSFEEVSVIFLEV---------MNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISP---FVYK 536
            .||:|.|.|:|..|         .|:..|||       :.:..||::.:..||.:..|   .|.|
Mouse   868 HQSYECVCVLFASVPDFKEFYSESNINHEGL-------ECLRLLNEIIADFDELLSKPKFSGVEK 925

  Fly   537 VETVGMVYMAVSG-----APDVNPLHAEHAC-------DLALRVMKK---FKAHDMGDVAIRVGI 586
            ::|:|..|||.:|     ..|... .:|.:|       :.|:.:..|   ...|...:..:|||:
Mouse   926 IKTIGSTYMAATGLNATSGQDTQQ-DSERSCSHLGTMVEFAVALGSKLGVINKHSFNNFRLRVGL 989

  Fly   587 NSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVK 651
            |.|||||||:|.:.|:|.::|:|||.||||||:....|||:::.|...::.:||...|||:::||
Mouse   990 NHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYSRGSIKVK 1054

  Fly   652 GKGDMETYWL 661
            |||::.||:|
Mouse  1055 GKGELCTYFL 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 9/52 (17%)
CYCc 457..643 CDD:214485 66/216 (31%)
Guanylate_cyc 485..662 CDD:278633 71/204 (35%)
Adcy4NP_001348533.1 AC_N <115..246 CDD:318454
Guanylate_cyc 264..418 CDD:306677
DUF1053 479..580 CDD:368844
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..524
Guanylate_cyc 866..1065 CDD:306677 71/207 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.