DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and MPND

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001287791.1 Gene:MPND / 84954 HGNCID:25934 Length:501 Species:Homo sapiens


Alignment Length:289 Identity:62/289 - (21%)
Similarity:112/289 - (38%) Gaps:86/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DIKISALALLKMVMHA---RSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEG----TETRVNAQA 108
            ::.:|:..|..:..|:   ||    ||:|.:.|:.:.|:.::....|.|...    .||....:.
Human   271 NVAVSSNVLFLLDFHSHLTRS----EVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEE 331

  Fly   109 QAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQ----------EPFV 163
            :.|:.:..         |....||||||||......|..|:..||   .||          :|.:
Human   332 EIYQSLFL---------RGLSLVGWYHSHPHSPALPSLQDIDAQM---DYQLRLQGSSNGFQPCL 384

  Fly   164 AIVVDPVRTVSAG-KVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFK 227
            |::..|..:.:.| :..:..|...|    ||.:.||:| .||::              :|::|.:
Human   385 ALLCSPYYSGNPGPESKISPFWVMP----PPEQRPSDY-GIPMD--------------VEMAYVQ 430

  Fly   228 SALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTG--QIMDLSEKLEQSENFLGRGTDVNEKRSED 290
               |..|.:.:.::          ::...|:..|  .::.|.|...|...:|            |
Human   431 ---DSFLTNDILHE----------MMLLVEFYKGSPDLVRLQEPWSQEHTYL------------D 470

  Fly   291 KL-----SKATRDCSR-STIELIHGLMAQ 313
            ||     |:..:|.|. ..:|.:.|::.|
Human   471 KLKISLASRTPKDQSLCHVLEQVCGVLKQ 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 59/279 (21%)
MPNDNP_001287791.1 MPN_2A_DUB 266..450 CDD:163698 48/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.