DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and BRCC3

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_005274808.1 Gene:BRCC3 / 79184 HGNCID:24185 Length:317 Species:Homo sapiens


Alignment Length:331 Identity:73/331 - (22%)
Similarity:121/331 - (36%) Gaps:95/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFA 94
            |.|..|.:.|...|.|            |.|..:.||.|....|||||.:|::.|:|......||
Human     2 AVQVVQAVQAVHLESD------------AFLVCLNHALSTEKEEVMGLCIGELNDDTSRSDSKFA 54

  Fly    95 LPVEGTETRVNA---------------------------QAQAYEYMTAYMEA---AKEVGRMEH 129
              ..|||.|..|                           :....:...|..||   |:..||...
Human    55 --YTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMR 117

  Fly   130 AVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVD---PVRTVSAGKVCLGAFRTY----- 186
            .||||||||....|.|.:||.||.:.|...:.||.::..   ..:....|:|....|::.     
Human   118 VVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKS 182

  Fly   187 ------PKGYKPPNE--------EPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALD------ 231
                  |:.:...::        |...|:.|      :..:|...:..:.....:||::      
Human   183 SESLHGPRDFWSSSQHISIEGQKEEERYERI------EIPIHIVPHVTIGKVCLESAVELPKILC 241

  Fly   232 -------RRL-----LDSLWNKYWVNTLGSSGLLTNTEYTTGQIMD-LSEKLEQSENFLGRGTDV 283
                   ||:     |||: .|....::.:..|.:.....:|.::. |.::|||::..|   .::
Human   242 QEEQDAYRRIHSLTHLDSV-TKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHL---QEL 302

  Fly   284 NEKRSE 289
            .:::.|
Human   303 QQEKEE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 69/320 (22%)
BRCC3XP_005274808.1 MPN_BRCC36 13..293 CDD:163699 64/300 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.