DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and PSMD7

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_002802.2 Gene:PSMD7 / 5713 HGNCID:9565 Length:324 Species:Homo sapiens


Alignment Length:291 Identity:54/291 - (18%)
Similarity:97/291 - (33%) Gaps:95/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMVMH----ARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE 112
            :.:..|.||.:|.|    .:.|....|:|::||..:...:.|.::||:|.:..:...:.....::
Human     9 VVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHD 73

  Fly   113 YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGK 177
            |:.......|:|...|..|||||:.|.    |...|::...|.:.|....|.:::|         
Human    74 YLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVIID--------- 125

  Fly   178 VCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKY 242
                   ..||....|.|     ..|.:.::.|.|....:.:                       
Human   126 -------VKPKDLGLPTE-----AYISVEEVHDDGTPTSKTF----------------------- 155

  Fly   243 WVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRSTI--- 304
                          |:.|.:|                |.:..|:...:.|.:..:|.:..|:   
Human   156 --------------EHVTSEI----------------GAEEAEEVGVEHLLRDIKDTTVGTLSQR 190

  Fly   305 --ELIHGLMAQIVKDKLFN------KVGLGK 327
              ..:|||..  :..||.:      ||..||
Human   191 ITNQVHGLKG--LNSKLLDIRSYLEKVATGK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 45/261 (17%)
PSMD7NP_002802.2 MPN_RPN7_8 7..285 CDD:163693 54/291 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.