DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and stambpl1

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_009304952.1 Gene:stambpl1 / 570542 ZFINID:ZDB-GENE-100215-4 Length:466 Species:Danio rerio


Alignment Length:159 Identity:37/159 - (23%)
Similarity:59/159 - (37%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEV-GRMEH----AV 131
            :|..|::.||:..|..::          |...|..|:...:|..  ||..:|: ...:|    .:
Zfish   275 IETCGVLCGKLTHNEFVL----------THVIVPKQSAGPDYCD--MENVEELFSYQDHHNLLTL 327

  Fly   132 GWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVS----------AGKVCLGAFRTY 186
            ||.|:||....:||.:|:.|....|......:|||..|....|          :|::.:..|   
Zfish   328 GWIHTHPTQTAFLSSVDLHTHSSYQLMLPEAIAIVCAPKHNESFPAHQCWNGRSGRMQIERF--- 389

  Fly   187 PKGYKPPNEEPSEYQTIPLNKIEDFGVHC 215
                .||.|.||        .:.....||
Zfish   390 ----SPPLERPS--------SVHYLQAHC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 37/159 (23%)
stambpl1XP_009304952.1 USP8_dimer 28..130 CDD:286108
MPN_AMSH_like 250..>369 CDD:163697 27/105 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.