DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and mysm1

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_021324132.1 Gene:mysm1 / 561225 ZFINID:ZDB-GENE-041014-28 Length:828 Species:Danio rerio


Alignment Length:323 Identity:76/323 - (23%)
Similarity:127/323 - (39%) Gaps:81/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QIIDAKPWEKDPHFFKDIKISALALLKMVMHAR-SGGTLEVMGLMLGKVEDNTMIVMDAFALPVE 98
            |:|..|.:.::......:.:.|.||:.|.:||. |.|  ||:||:.|..|:...::....|.|..
Zfish   506 QLIPCKTFGEERQEPYSVIVCAEALIVMDIHAHVSMG--EVIGLLGGTYEEEDKVLKICSAEPCN 568

  Fly    99 GTETRVN------AQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQT 157
            ...|.:.      :|.||.|.:     ..|.:.    .||||||||.:....|..|:.||...|:
Zfish   569 SLSTGLQCEMDPVSQTQASEVL-----GVKGLS----VVGWYHSHPAFDPNPSLRDIDTQAKYQS 624

  Fly   158 Y----QEPFVAIVVDPVRTVSAG----KVCL------GAFRTYPKG-YKPP-------NEEPSEY 200
            |    ..||:.::|.|....::.    ..||      |     |.| :|.|       :.||.::
Zfish   625 YFSRGGAPFIGMIVSPYNPSNSSPQSQSTCLLVQEEPG-----PSGSHKFPYQFNMQCSAEPPDW 684

  Fly   201 Q------------------TIPLNKI--EDFGVHCKQYYPLEISYFKSALDRR----------LL 235
            .                  ::|::::  .|..:.|.:...|.|   ::.|:|.          .|
Zfish   685 SEVMRRAEWVVFKYRLCHGSVPMDRLFRRDSSLTCLEKMLLSI---RTVLERLSEVDIETFLVQL 746

  Fly   236 DSLWNKYWVNTLGSSGLLTNTEYTTGQIMDL--SEKLEQS-ENFLGRGTDVNEKRSEDKLSKA 295
            :||:|.::::..|||........|..|::..  ||.:..| ......|.|.......|||.::
Zfish   747 ESLFNTHFLSETGSSSTHLYETATQPQLLSFLSSEPISSSATEETSDGHDEPNTTGPDKLEQS 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 73/317 (23%)
mysm1XP_021324132.1 SANT 107..150 CDD:238096
SWIRM 331..408 CDD:309539
MPN_2A_DUB 517..699 CDD:163698 49/197 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.