DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and mpnd

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001070033.1 Gene:mpnd / 559169 ZFINID:ZDB-GENE-060929-1162 Length:458 Species:Danio rerio


Alignment Length:282 Identity:59/282 - (20%)
Similarity:105/282 - (37%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSDAAQKTWELEN-NIQTLPSCDEIFRYDAEQQRQI------IDAKPWEKDPHFFKD-------- 51
            |.:..:.|..:|: |.::.|...||.......:.:|      :..:...:|||...:        
Zfish   158 DEEEGKTTIPVEDKNKKSKPELHEIGLTQRRDRERIPVRYCTLGTRDAARDPHTLVELSAFSAIN 222

  Fly    52 ------IKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQA 110
                  :.:|:..||.|..|.....: ||:|.:.|:.:.||.::....|.|   ..||:      
Zfish   223 RFQPFNVAVSSNVLLLMDFHCHLTSS-EVVGYLGGRWDTNTQLLTVLRAFP---CRTRL------ 277

  Fly   111 YEYMTAYMEAAKEVG---------RMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQ------- 159
                 |..:||..|.         |....||||||||......|..|:.:||.:|...       
Zfish   278 -----ADKDAAPAVEEEICQNLFMRGLSLVGWYHSHPRGPALPSLQDIDSQMDHQLRLQGSSNGF 337

  Fly   160 EPFVAIVVDPVRTVSAGKV-CLGAFRTYPKGYKPPNEEPSEY---QTIPLNKIED--FGVHCKQY 218
            :|.:.|:..|....:.|.. .:..|...|    ||.:.|:::   ..:.:..::|  ........
Zfish   338 QPCLGIICGPYYHGNQGVASTITPFWVVP----PPEQRPNDHGIPVAVEVTYVQDNFLTTDVLNE 398

  Fly   219 YPLEISYFKSALDRRLLDSLWN 240
            ..|.:.:::||.|......:|:
Zfish   399 MMLLVEFYRSAPDLVQFSQMWS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 51/236 (22%)
mpndNP_001070033.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..175 4/16 (25%)
MPN_2A_DUB 223..407 CDD:163698 44/202 (22%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 306..319 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.