DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and eIF3h

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_524834.2 Gene:eIF3h / 45682 FlyBaseID:FBgn0022023 Length:338 Species:Drosophila melanogaster


Alignment Length:279 Identity:68/279 - (24%)
Similarity:111/279 - (39%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMVMHA--RSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYM 114
            ::...||::|||.|.  .|.......|.:||.|.|..:.:.:.|..|..|.||.....     |.
  Fly    22 VQCDGLAVMKMVKHCHEESSNMDLAQGALLGLVVDKCLEITNCFPFPKSGDETMDEEM-----YQ 81

  Fly   115 TAYMEAAKEVGRMEHA-VGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKV 178
            ...|...:.| .::|. ||||.| ...|..||...:.:|...||..|..|.:|.|..:: |.|.:
  Fly    82 LTVMRRLRRV-NVDHLHVGWYQS-SDVGNSLSMALLESQYHYQTSIEESVVVVYDTQKS-SRGFL 143

  Fly   179 CLGAFRTYPKG---YKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWN 240
            ||.|:|..|:.   ||..:..|..::|                  |::.|          ::|:.
  Fly   144 CLKAYRLTPQAIQMYKDGDFTPEAFRT------------------LKVGY----------ENLFA 180

  Fly   241 KYWVNTLGSSGLLTNTEYTTGQIMDLSEKL--EQSENFLGRGTDVNEKRSEDKLSKATRDCSRST 303
            :..:       ::.|:..|...:.:|:|.|  ::..|||..||           :....:..||.
  Fly   181 EIPI-------VIKNSPLTNIMMSELNELLPEDKGHNFLDLGT-----------ATVLENQMRSL 227

  Fly   304 IELIHGLMAQIVKDKLFNK 322
            ||.:..|..:.|:   :||
  Fly   228 IERVDELYQEAVR---YNK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 62/260 (24%)
eIF3hNP_524834.2 MPN_eIF3h 20..281 CDD:163696 68/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10410
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.