DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and psmd7

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001032349.1 Gene:psmd7 / 447971 XenbaseID:XB-GENE-1005422 Length:320 Species:Xenopus tropicalis


Alignment Length:248 Identity:50/248 - (20%)
Similarity:96/248 - (38%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMVMH----ARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE 112
            :.:..|.||.:|.|    .:.|....|:|::||......:.|.::||:|.:..:...:.....::
 Frog     9 VVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSVWFLDHD 73

  Fly   113 YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGK 177
            |:.......|:|...|..|||||:.|.    |...|::...|.:.|....|.:::|         
 Frog    74 YLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVIID--------- 125

  Fly   178 VCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKY 242
                   ..||....|.|     ..|.:.::.|.|....:.:    .:..|.:.....:.:..::
 Frog   126 -------VKPKDLGLPTE-----AYISVEEVHDDGTPTSKTF----EHVTSEIGAEEAEEVGVEH 174

  Fly   243 WVNTLGSSGLLTNTEYTTGQI---MDLSEKLEQSENFLGRGTDVNEKRSEDKL 292
            .:..:..:.:.|.::..|.|:   ..|:.||....::|       ||.|..||
 Frog   175 LLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYL-------EKVSSGKL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 50/248 (20%)
psmd7NP_001032349.1 MPN_RPN7_8 7..285 CDD:163693 50/248 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.