DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and Rpn11

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster


Alignment Length:287 Identity:97/287 - (33%)
Similarity:155/287 - (54%) Gaps:28/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KDIKISALALLKMVMHARSGGTLEVMGLMLGK-VEDNTMIVMDAFALPVEGTETRVNAQAQAYEY 113
            :.:.||:||||||:.|.|:|..:||||||||: |:|.|:.|:|.||:|..||...|.|....:: 
  Fly    27 EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVDPVFQ- 90

  Fly   114 MTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKV 178
             ...::..|:.||.|..|||||||||:||||||:|::||...:...|..||:||||:::|. |||
  Fly    91 -AKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVK-GKV 153

  Fly   179 CLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHC------KQYYPLEISYFKSALDRRLLDS 237
            .:.|||..........:||.: .|..|..::...|..      :.||.:.|:|.|:.|::::|.:
  Fly   154 VIDAFRLINPNMLVLGQEPRQ-TTSNLGHLQKPSVQALIHGLNRHYYSISINYRKNELEQKMLLN 217

  Fly   238 LWNKYWVNTLGSSGL---LTNTEYTTGQIMDL----SEKLEQSENFLGR-------GTDVNEKRS 288
            |..|.|.:.|..|..   .:..|.|..:::||    ::.||..|.....       |....::..
  Fly   218 LHKKSWKDGLTLSDYNEHCSINEDTVAEMLDLAKNYNKSLEDEEKMTPEQLAIKNVGKQDPKRHL 282

  Fly   289 EDKLSKATRDCSRSTIELIHGLMAQIV 315
            |:|:.|..::   :.::.:..::..||
  Fly   283 EEKVDKVMQN---NIVQCLGAMLDTIV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 95/275 (35%)
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 92/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031881at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10410
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.