DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and Brcc3

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001120772.1 Gene:Brcc3 / 316794 RGDID:1588543 Length:291 Species:Rattus norvegicus


Alignment Length:275 Identity:62/275 - (22%)
Similarity:107/275 - (38%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTM-------IVMDAFALPVEGTETRV----- 104
            :.:.:.|.|..:.||.|....|||||.:|::.|:..       ...|...:|.:....||     
  Rat    12 VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDVRSESKFAHAGSDVCTVPEKVDSIRVVHIHS 76

  Fly   105 ------------NAQAQAYEYMTAYMEA---AKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQML 154
                        ..:....:...|..||   |:..||....||||||||....|.|.:||.||.:
  Rat    77 VIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAM 141

  Fly   155 NQTYQEPFVAIVVD---PVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCK 216
            .|...:.||.::..   ..:....|:|....|::...      ::.|:|:.|      :..||..
  Rat   142 YQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSVQA------QKSSDYERI------EIPVHVV 194

  Fly   217 QYYPLEISYFKSALD-------------RRL-----LDSLWNKYWVNTLGSSGLLTNTEYTTGQI 263
            .:..:.....:||::             ||:     |||: .|....::.:..|.:.....:|.:
  Rat   195 PHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSV-TKIHNGSVFTKNLCSQMSAVSGPL 258

  Fly   264 MD-LSEKLEQSENFL 277
            :. |.::|||::..|
  Rat   259 LQWLEDRLEQNQQHL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 62/275 (23%)
Brcc3NP_001120772.1 MPN_BRCC36 13..270 CDD:163699 61/269 (23%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 122..135 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.