DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and Cops6

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001100599.1 Gene:Cops6 / 304343 RGDID:1309919 Length:344 Species:Rattus norvegicus


Alignment Length:71 Identity:20/71 - (28%)
Similarity:35/71 - (49%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 MHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRME 128
            |.::.|..::|:|.::||.|...:.||::|.|.....|.::....   ||.....|..|:|.:..
  Rat    75 MRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEKKIIIDK---EYYYTKEEQFKQVFKEL 136

  Fly   129 HAVGWY 134
            ..:|||
  Rat   137 EFLGWY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 20/71 (28%)
Cops6NP_001100599.1 MPN_CSN6 56..338 CDD:163694 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.