DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and Mysm1

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_008762133.1 Gene:Mysm1 / 298247 RGDID:1311787 Length:811 Species:Rattus norvegicus


Alignment Length:302 Identity:68/302 - (22%)
Similarity:110/302 - (36%) Gaps:96/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSDAA-QKTWELEN---------------------NIQTLP--SCDEIFRYDAEQQRQIIDAKPW 42
            |::|| |..|.|::                     ..||..  |.:|:.|.:.|::.:.|.....
  Rat   467 DAEAAYQLAWRLQSMRTRRRRVRDPWGNWCDAKDLEGQTFEHLSVEELARREEEEKCKPIKFSKA 531

  Fly    43 EK------DP------HFFK-------DIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMI 88
            .|      ||      |||.       .:|:::.|||.|.:||.. ...||:||:.|:..:...:
  Rat   532 SKLPKSSLDPFQLIPCHFFSGEKQEPFQVKVASEALLIMDLHAHV-SMAEVIGLLGGRYSEADKV 595

  Fly    89 VMDAFALPVEGTETRVN------AQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGI 147
            :....|.|.....|.:.      :|.||.|.:..         |....:|||||||.:....|..
  Rat   596 LEVCAAEPCNSLSTGLQCEMDPVSQTQASETLAL---------RGCSVIGWYHSHPAFDPNPSLR 651

  Fly   148 DVSTQMLNQTY----QEPFVAIVVDPVRTVS----AGKVCL---------GAFR-TYPKGYKPPN 194
            |:.||...|:|    ...|:.::|.|....:    :...||         |.:| .|....:...
  Rat   652 DIDTQAKYQSYFSRGGAKFIGMIVSPYNRSNPLPYSQITCLVISEELSPDGTYRLPYKFEVQQML 716

  Fly   195 EEPS-----------------EYQTIPLNKI--EDFGVHCKQ 217
            |||.                 .:.::|:::|  .|..:.|.|
  Rat   717 EEPQWELVFEKTRWIIEKYRLSHSSVPMDRIFRRDSDLTCLQ 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 55/239 (23%)
Mysm1XP_008762133.1 Myb_DNA-binding 116..160 CDD:395191
SWIRM 365..444 CDD:398234
MPN_2A_DUB 554..736 CDD:163698 44/191 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.