DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and Eif3f

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001264231.1 Gene:Eif3f / 293427 RGDID:1306112 Length:361 Species:Rattus norvegicus


Alignment Length:275 Identity:61/275 - (22%)
Similarity:111/275 - (40%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMV--MHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYM 114
            :::..:.|..:|  ...|:.|...|:|.:||.|:.:::.|.:.|::|...:|..|   |...|:.
  Rat    96 VRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEV---AVDMEFA 157

  Fly   115 TAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVS--TQMLNQTYQEPFVAIVVDPVR-TVSAG 176
            ....|..|:|...|..:|||         .:|.|::  :.::::.|...    ..:|:. ||..|
  Rat   158 KNMYELHKKVSPNELILGWY---------ATGHDITEHSVLIHEYYSRE----APNPIHLTVDTG 209

  Fly   177 KVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNK 241
               |...|...|.|      .|....:|...:   ||   .:.||.:.|.....:|..:|     
  Rat   210 ---LQNGRMSIKAY------VSTLMGVPGRTM---GV---MFTPLTVKYAYYDTERIGVD----- 254

  Fly   242 YWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNE---KRSEDKLS-KATRDCSRS 302
                      |:..|.::..:::.||..|:|......|..|...   :.:||.|| |.:.|   :
  Rat   255 ----------LIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSAD---N 306

  Fly   303 TI-ELIHGLMAQIVK 316
            |: ..:..|:.|:.|
  Rat   307 TVGRFLMSLVNQVPK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 58/262 (22%)
Eif3fNP_001264231.1 MPN_eIF3f 96..358 CDD:163695 61/275 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.