powered by:
Protein Alignment CSN5 and Cops6
DIOPT Version :9
Sequence 1: | NP_477442.1 |
Gene: | CSN5 / 42000 |
FlyBaseID: | FBgn0027053 |
Length: | 327 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_036132.1 |
Gene: | Cops6 / 26893 |
MGIID: | 1349439 |
Length: | 324 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 35/71 - (49%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 MHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRME 128
|.::.|..::|:|.::||.|...:.||::|.|.....|.::.... ||.....|..|:|.:..
Mouse 55 MRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDK---EYYYTKEEQFKQVFKEL 116
Fly 129 HAVGWY 134
..:|||
Mouse 117 EFLGWY 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1310 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.