DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and Cops6

DIOPT Version :10

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_036132.1 Gene:Cops6 / 26893 MGIID:1349439 Length:324 Species:Mus musculus


Alignment Length:71 Identity:20/71 - (28%)
Similarity:35/71 - (49%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 MHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRME 128
            |.::.|..::|:|.::||.|...:.||::|.|.....|.::....   ||.....|..|:|.:..
Mouse    55 MRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDK---EYYYTKEEQFKQVFKEL 116

  Fly   129 HAVGWY 134
            ..:|||
Mouse   117 EFLGWY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 20/71 (28%)
Cops6NP_036132.1 MPN_CSN6 36..318 CDD:163694 20/71 (28%)

Return to query results.
Submit another query.