DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and F37A4.5

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_498470.1 Gene:F37A4.5 / 185404 WormBaseID:WBGene00018135 Length:319 Species:Caenorhabditis elegans


Alignment Length:301 Identity:105/301 - (34%)
Similarity:158/301 - (52%) Gaps:37/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGK-VEDNTMIVMDAFALPVEGTETRVNAQAQ 109
            |...:.:.||:||||||:.|||||..|||||||||. |:|.|:.|.|.||:|..||...|.:...
 Worm    23 PDTSETVNISSLALLKMLRHARSGIPLEVMGLMLGDFVDDYTINVTDVFAMPQSGTSVTVESVDP 87

  Fly   110 AYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVS 174
            .|:  |.:|:..|.|||.|:.|||||||||:|||||.:||:||...:......||:||||:::|.
 Worm    88 VYQ--TKHMDLLKLVGRTENVVGWYHSHPGFGCWLSSVDVNTQQSFEALHPRAVAVVVDPIQSVK 150

  Fly   175 AGKVCLGAFRTY-PKGYK----PPNEEPSE------YQTIP--LNKIEDFGVHCKQYYPLEISYF 226
             |||.|.|||:. |...:    .|..||.:      :.|.|  ::.:...|.   :||.|.::|.
 Worm   151 -GKVMLDAFRSVNPLNLQIRPLAPTAEPRQTTSNLGHLTKPSLISVVHGLGT---KYYSLNVAYR 211

  Fly   227 KSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFL----GRGTD-VNEK 286
            ..:.::::|..|..|.|.:.|..|        |..::....|:..:|.|.|    .:..| |.||
 Worm   212 MGSNEQKMLMCLNKKSWYDQLNMS--------TYSELEKKQEEKFKSINKLIAVFNKDIDEVKEK 268

  Fly   287 RSEDKLSKATRDCSR----STIELIHGLMAQIVKDKLFNKV 323
            ...||..|...:..:    :..:.:..:.:.::.|.|.:::
 Worm   269 PIADKKGKTQEEVKKFGKINAKQQLQMITSSLLNDSLCHQL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 103/281 (37%)
F37A4.5NP_498470.1 MPN_RPN11_CSN5 22..296 CDD:163700 103/286 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031881at2759
OrthoFinder 1 1.000 - - FOG0002867
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.