DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and eif-3.F

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_495988.1 Gene:eif-3.F / 174478 WormBaseID:WBGene00001229 Length:294 Species:Caenorhabditis elegans


Alignment Length:273 Identity:59/273 - (21%)
Similarity:93/273 - (34%) Gaps:95/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHA 130
            |::.|..:.||.::|..|..::.|.:.||:|...:...:....|..:.|   :.|.|:....|..
 Worm    29 AKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPFNESNDDLEIDDQFNQQM---ISALKKTSPNEQP 90

  Fly   131 VGW-------------YHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVD-----------PVR 171
            |||             ||.:  |      :.|.|:...:....|.|.:.:|           |||
 Worm    91 VGWFLTTSDITSSCLIYHDY--Y------VRVITEASARRESPPIVVLTIDTTFSGDMSKRMPVR 147

  Fly   172 TVSAGKVCL-GAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPL--EISYF------- 226
            .....|..: ||                            .|.||..:.||  |::.|       
 Worm   148 AYLRSKAGIPGA----------------------------AGPHCAIFNPLRVELAAFPGELVAM 184

  Fly   227 ---KSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVN---E 285
               :.|||.|..::        ||.|.  |...|.:|.|:      :|..|..|....|||   |
 Worm   185 QLIEKALDSRRREA--------TLESG--LEQLETSTAQM------IEWLERMLHYVEDVNKNGE 233

  Fly   286 KRSEDKLSKATRD 298
            |..:.::.:...|
 Worm   234 KPGDAQIGRQLMD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 59/273 (22%)
eif-3.FNP_495988.1 MPN_eIF3f 7..291 CDD:163695 59/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.