DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN5 and rpn-8

DIOPT Version :9

Sequence 1:NP_477442.1 Gene:CSN5 / 42000 FlyBaseID:FBgn0027053 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_491319.1 Gene:rpn-8 / 172009 WormBaseID:WBGene00004464 Length:362 Species:Caenorhabditis elegans


Alignment Length:252 Identity:58/252 - (23%)
Similarity:98/252 - (38%) Gaps:62/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IKISALALLKMVMH----ARSGGTLEVMGLMLGKV-EDNTMIVMDAFALPVEGTETRVNAQAQAY 111
            :.:..|.||.:|.|    :::.....|:|::||.: :|.|:.:.::||:|.:..:...:......
 Worm    41 VTVHPLVLLSVVDHFNRVSKTQSVKRVVGVLLGSMKKDKTLDIGNSFAVPFDEDDKDKSTWFLDM 105

  Fly   112 EYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVS-TQMLNQTYQEPFVAIVVDPVRTVSA 175
            :|:.:......:|...|..|||||:.|.    |...|:: .:.|.:....| |.:::|       
 Worm   106 DYLESMYGMFYKVAAKEKIVGWYHTGPK----LHKNDIAINEQLKRFCPNP-VLVIID------- 158

  Fly   176 GKVCLGAFRTYPKGYKPPNEEPSEYQ------TIPLNKIE----DFGVHCKQYYPLEISYFKSAL 230
                     ..||....|.|...|.|      |.|:...|    |.|....:...:|      .|
 Worm   159 ---------AEPKNIGLPTEAYIEVQEVHDDGTPPIKTFEHVPSDIGAEEAEEVGVE------HL 208

  Fly   231 DRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIM---DLSEKLEQSENFLG---RGT 281
            .|.:.|        .|.|     |.::..|.|:|   .|..:||..|.:|.   |||
 Worm   209 LRDIKD--------QTAG-----TLSQRITDQLMGLRGLQSQLESIEKYLHDIVRGT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN5NP_477442.1 MPN_RPN11_CSN5 41..305 CDD:163700 58/252 (23%)
rpn-8NP_491319.1 MPN_RPN7_8 39..320 CDD:163693 58/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.